Recombinant Human IL20RB protein, His-tagged
Cat.No. : | IL20RB-4551H |
Product Overview : | Recombinant Human IL20RB protein(Q6UXL0)(30-233aa), fused to N-terminal His tag, was expressed in E. coli |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 30-233aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 26.9 kDa |
AA Sequence : | DEVAILPAPQNLSVLSTNMKHLLMWSPVIAPGETVYYSVEYQGEYESLYTSHIWIPSSWCSLTEGPECDVTDDITATVPYNLRVRATLGSQTSAWSILKHPFNRNSTILTRPGMEITKDGFHLVIELEDLGPQFEFLVAYWRREPGAEEHVKMVRSGGIPVHLETMEPGAAYCVKAQTFVKAIGRYSAFSQTECVEVQGEAIPL |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | IL20RB interleukin 20 receptor beta [ Homo sapiens ] |
Official Symbol | IL20RB |
Synonyms | IL20RB; interleukin 20 receptor beta; fibronectin type III domain containing 6 , FNDC6; interleukin-20 receptor subunit beta; DIRS1; IL 20R2; MGC34923; IL-20RB; IL-20R-beta; interleukin-20 receptor II; IL-20 receptor subunit beta; fibronectin type III domain containing 6; FNDC6; IL-20R2; |
Gene ID | 53833 |
mRNA Refseq | NM_144717 |
Protein Refseq | NP_653318 |
MIM | 605621 |
UniProt ID | Q6UXL0 |
◆ Recombinant Proteins | ||
Il20rb-7451R | Recombinant Rat Il20rb protein(Met1-Pro227), His-tagged | +Inquiry |
IL20RB-762H | Recombinant Human IL20RB | +Inquiry |
IL20RB-2064R | Recombinant Rhesus Macaque IL20RB Protein, His (Fc)-Avi-tagged | +Inquiry |
IL20RB-221H | Recombinant Human IL20RB protein, His-tagged | +Inquiry |
IL20RB-2243R | Recombinant Rhesus monkey IL20RB Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
IL20RB-1495RCL | Recombinant Rat IL20RB cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All IL20RB Products
Required fields are marked with *
My Review for All IL20RB Products
Required fields are marked with *