Recombinant Human IL20RB protein, His-tagged
| Cat.No. : | IL20RB-4551H |
| Product Overview : | Recombinant Human IL20RB protein(Q6UXL0)(30-233aa), fused to N-terminal His tag, was expressed in E. coli |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 30-233aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 26.9 kDa |
| AA Sequence : | DEVAILPAPQNLSVLSTNMKHLLMWSPVIAPGETVYYSVEYQGEYESLYTSHIWIPSSWCSLTEGPECDVTDDITATVPYNLRVRATLGSQTSAWSILKHPFNRNSTILTRPGMEITKDGFHLVIELEDLGPQFEFLVAYWRREPGAEEHVKMVRSGGIPVHLETMEPGAAYCVKAQTFVKAIGRYSAFSQTECVEVQGEAIPL |
| Purity : | Greater than 85% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
| Gene Name | IL20RB interleukin 20 receptor beta [ Homo sapiens ] |
| Official Symbol | IL20RB |
| Synonyms | IL20RB; interleukin 20 receptor beta; fibronectin type III domain containing 6 , FNDC6; interleukin-20 receptor subunit beta; DIRS1; IL 20R2; MGC34923; IL-20RB; IL-20R-beta; interleukin-20 receptor II; IL-20 receptor subunit beta; fibronectin type III domain containing 6; FNDC6; IL-20R2; |
| Gene ID | 53833 |
| mRNA Refseq | NM_144717 |
| Protein Refseq | NP_653318 |
| MIM | 605621 |
| UniProt ID | Q6UXL0 |
| ◆ Recombinant Proteins | ||
| IL20RB-5655H | Active Recombinant Human IL20RB Protein, Fc-tagged | +Inquiry |
| Il20rb-654M | Active Recombinant Mouse Il20rb, Fc Chimera | +Inquiry |
| IL20RB-447C | Recombinant Cynomolgus IL20RB Protein, Fc-tagged | +Inquiry |
| IL20RB-2243R | Recombinant Rhesus monkey IL20RB Protein, His-tagged | +Inquiry |
| IL20RB-762H | Recombinant Human IL20RB | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| IL20RB-1495RCL | Recombinant Rat IL20RB cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All IL20RB Products
Required fields are marked with *
My Review for All IL20RB Products
Required fields are marked with *



