Recombinant Human IL3 Protein, GMP Grade, Animal-Free

• Cat.No.: IL3-32HG
• Product Overview: GMP Recombinant Human IL3 protein with out tag was expressed in E. coli and manufactured using animal-derived component free materials.

Specification

• Species: Human
• Source: E.coli
• Description: IL-3 is a hematopoietic growth factor that promotes the survival, differentiation and proliferation of committed progenitor cells of the megakaryocyte, granulocyte-macrophage, erythroid, eosinophil, basophil and mast cell lineages. Produced by T cells, mast cells and eosinophils, IL-3 enhances thrombopoiesis, phagocytosis, and antibody-mediated cellular cytotoxicity. Its ability to activate monocytes suggests that IL-3 may have additional immunoregulatory roles. Many of the IL-3 activities depend upon co-stimulation with other cytokines. IL-3 is a species-specific, variably glycosylated cytokine.
• AA Sequence: APMTQTTSLKTSWVNCSNMIDEIITHLKQPPLPLLDFNNLNGEDQDILMENNLRRPNLEAFNRAVKSLQNASAIESILKNLLPCLPLATAAPTRHPIHIKDGDWNEFRRKLTFYLKTLENAQAQQTTLSLAIF
• Purity: ≥ 98% by SDS-PAGE gel and HPLC analyses.

Gene Information

• Gene Name: IL3 interleukin 3 (colony-stimulating factor, multiple) [ Homo sapiens (human) ]
• Official Symbol: IL3
• Synonyms: IL3; interleukin 3 (colony-stimulating factor, multiple); interleukin-3; hematopoietic growth factor; IL 3; mast cell growth factor; MCGF; MGC79398; MGC79399; MULTI CSF; multilineage colony stimulating factor; P cell stimulating factor; mast-cell growth factor; P-cell stimulating factor; P-cell-stimulating factor; multilineage-colony-stimulating factor; multipotential colony-stimulating factor; IL-3; MULTI-CSF
• Gene ID: 3562
• mRNA Refseq: NM_000588
• Protein Refseq: NP_000579
• MIM: 147740
• UniProt ID: P08700