Recombinant Human IL3 Protein, GMP Grade, Animal-Free
Cat.No. : | IL3-32HG |
Product Overview : | GMP Recombinant Human IL3 protein with out tag was expressed in E. coli and manufactured using animal-derived component free materials. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Description : | IL-3 is a hematopoietic growth factor that promotes the survival, differentiation and proliferation of committed progenitor cells of the megakaryocyte, granulocyte-macrophage, erythroid, eosinophil, basophil and mast cell lineages. Produced by T cells, mast cells and eosinophils, IL-3 enhances thrombopoiesis, phagocytosis, and antibody-mediated cellular cytotoxicity. Its ability to activate monocytes suggests that IL-3 may have additional immunoregulatory roles. Many of the IL-3 activities depend upon co-stimulation with other cytokines. IL-3 is a species-specific, variably glycosylated cytokine. |
AA Sequence : | APMTQTTSLKTSWVNCSNMIDEIITHLKQPPLPLLDFNNLNGEDQDILMENNLRRPNLEAFNRAVKSLQNASAIESILKNLLPCLPLATAAPTRHPIHIKDGDWNEFRRKLTFYLKTLENAQAQQTTLSLAIF |
Purity : | ≥ 98% by SDS-PAGE gel and HPLC analyses. |
Gene Name | IL3 interleukin 3 (colony-stimulating factor, multiple) [ Homo sapiens (human) ] |
Official Symbol | IL3 |
Synonyms | IL3; interleukin 3 (colony-stimulating factor, multiple); interleukin-3; hematopoietic growth factor; IL 3; mast cell growth factor; MCGF; MGC79398; MGC79399; MULTI CSF; multilineage colony stimulating factor; P cell stimulating factor; mast-cell growth factor; P-cell stimulating factor; P-cell-stimulating factor; multilineage-colony-stimulating factor; multipotential colony-stimulating factor; IL-3; MULTI-CSF; |
Gene ID | 3562 |
mRNA Refseq | NM_000588 |
Protein Refseq | NP_000579 |
MIM | 147740 |
UniProt ID | P08700 |
◆ Recombinant Proteins | ||
Il3-642R | Recombinant Rat Il3 protein, His & T7-tagged | +Inquiry |
IL3-131H | Recombinant Human IL3 protein, His-Avi-tagged | +Inquiry |
Il3-674M | Recombinant Mouse Il3 protein, hFc-tagged | +Inquiry |
Il3-09M | Recombinant Mouse Il3 protein | +Inquiry |
Il3-366M | Recombinant Mouse Il3 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
IL3-607HCL | Recombinant Human IL3 cell lysate | +Inquiry |
IL3-445RCL | Recombinant Rat IL3 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All IL3 Products
Required fields are marked with *
My Review for All IL3 Products
Required fields are marked with *
0
Inquiry Basket