| Species : |
Human |
| Source : |
HEK293 |
| Tag : |
His |
| Protein Length : |
1-131 aa |
| Description : |
This gene encodes a member of the cytokine family. The protein contains a tyrosine sulfation site, 3 potential N-myristoylation sites, multiple putative phosphorylation sites, and an RGD cell-attachment sequence. Expression of this protein is increased after the activation of T-cells by mitogens or the activation of NK cells by IL-2. This protein induces the production of TNFalpha from macrophage cells. Alternate transcriptional splice variants, encoding different isoforms, have been characterized. |
| Molecular Mass : |
22 kDa |
| AA Sequence : |
MCFPKVLSDDMKKLKARMVMLLPTSAQGLGAWVSACDTEDTVGHLGPWRDKDPALWCQLCLSSQHQAIERFYDKMQNAESGRGQVMSSLAELEDDFKEGYLETVAAYYEEQHPELTPLLEKERDGLRCRG |
| Endotoxin : |
Endotoxin content was assayed using a LAL gel clot method. Endotoxin level was found to be less than 0.1 ng/μg (1 EU/μg). |
| Purity : |
> 95%, as determined by SDS-PAGE and HPLC |
| Usage : |
This product is for research purposes only. It may not be used for therapeutics or diagnostic purposes. |
| Storage : |
The lyophilized protein is stable for at least 2 years from date of receipt at -20 centigrade. |
| Storage Buffer : |
Recombinant IL32 was lyophilized from 0.2 μm filtered PBS solution pH7.4 |
| Reconstitution : |
A quick spin of the vial followed by reconstitution in distilled water to a concentration not less than 0.1 mg/mL. This solution can then be diluted into other buffers. |
