Recombinant Human IL36A Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | IL36A-3232H |
Product Overview : | IL1F6 MS Standard C13 and N15-labeled recombinant protein (NP_055255) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | The protein encoded by this gene is a cytokine that can activate NF-kappa-B and MAPK signaling pathways to generate an inflammatory response. The encoded protein functions primarily in skin and demonstrates increased expression in psoriasis. In addition, decreased expression of this gene has been linked to a poor prognosis in both hepatocellular carcinoma and colorectal cancer patients. |
Molecular Mass : | 17.7 kDa |
AA Sequence : | MEKALKIDTPQRGSIQDINHRVWVLQDQTLIAVPRKDRMSPVTIALISCRHVETLEKDRGNPIYLGLNGLNLCLMCAKVGDQPTLQLKEKDIMDLYNQPEPVKSFLFYHSQSGRNSTFESVAFPGWFIAVSSEGGCPLILTQELGKANTTDFGLTMLFTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | IL36A interleukin 36 alpha [ Homo sapiens (human) ] |
Official Symbol | IL36A |
Synonyms | IL36A; interleukin 36, alpha; IL1F6, interleukin 1 family, member 6 (epsilon); interleukin-36 alpha; FIL1; FIL1E; IL 1F6; IL1(EPSILON); MGC129552; MGC129553; FIL1 epsilon; IL-1 epsilon; interleukin-1 epsilon; IL-1F6 (FIL-1-epsilon); interleukin 1, epsilon; interleukin-1 family member 6; interleukin 1 family, member 6 (epsilon); IL1F6; IL-1F6; FIL1(EPSILON); |
Gene ID | 27179 |
mRNA Refseq | NM_014440 |
Protein Refseq | NP_055255 |
MIM | 605509 |
UniProt ID | Q9UHA7 |
◆ Recombinant Proteins | ||
IL36A-195H | Recombinant Active Human IL36A Protein, His-tagged(C-ter) | +Inquiry |
Il1f6-382M | Recombinant Mouse Il1f6 protein(Met1-His160) | +Inquiry |
Il36a-249M | Active Recombinant Mouse Il36a Protein (Met1-His160), C-His tagged, Animal-free, Carrier-free | +Inquiry |
Il36a-3506M | Recombinant Mouse Il36a Protein, Myc/DDK-tagged | +Inquiry |
IL36A-151H | Recombinant Human IL36A Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
IL36A-5238HCL | Recombinant Human IL1F6 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All IL36A Products
Required fields are marked with *
My Review for All IL36A Products
Required fields are marked with *