Recombinant Mouse Il1f6 protein
Cat.No. : | Il1f6-550M |
Product Overview : | Recombinant Mouse Il1f6 protein (160 a.a.) was expressed in Escherichia coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Tag : | Non |
Protein Length : | 160 |
Description : | Interleukin-36 (IL-36) is a pro-inflammatory cytokine which plays an important role in the pathophysiology of several diseases. IL-36α, IL-36β, and IL-36γ (formerly IL-1F6, IL-1F8, and IL-1F9) are IL-1 family members that signal through the IL-1 receptor family members IL-1Rrp2 (IL-1RL2) and IL-1RAcP. IL-36α is mainly found in skin and lymphoid tissues, but also in fetal brain, trachea, stomach and intestine. It is expressed by monocytes, B and T cells. Notably, IL-36 alpha is the only novel IL-1 family member expressed on T-cells. Recombinant murine interleukin-36 alpha contains 160 amino acids residues which is a single non-glycosylated polypeptide. Specifically, mouse IL-36α shares 83 % a.a. sequence identity with rat IL-36α, 54-60 % with human, rabbit, equine and bovine IL-36α. |
Form : | Lyophilized from a 0.2μm filtered concentrated solution in PBS, pH 7.4, 5 % trehalose. |
Bio-activity : | Fully biologically active when compared to standard. The specific activity determined by its ability in a functional ELISA. Immobilized rMuIL-36α at 1 µg/mL can bind recombinant murine IL-1 Rrp2 with a range of 0.15-5 µg/mL. |
Molecular Mass : | Approximately 18.0 kDa, a single non-glycosylated polypeptide chain containing 160 amino acids. |
AA Sequence : | MNKEKELRAASPSLRHVQDLSSRVWILQNNILTAVPRKEQTVPVTITLLPCQYLDTLETNRGDPTYMGVQRPMSCLFCTKDGEQPVLQLGEGNIMEMYNKKEPVKASLFYHKKSGTTSTFESAAFPGWFIAVCSKGSCPLILTQELGEIFITDFEMIVVH |
Endotoxin : | Less than 1 EU/μg of rMuIL-36α, 160a.a. as determined by LAL method. |
Purity : | >95% by SDS-PAGE and HPLC analysis. |
Storage : | Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions. |
Gene Name | Il1f6 |
Official Symbol | Il1f6 |
Synonyms | FIL1 epsilon, IL-1 epsilon, IL-1F6, IL-1H1 |
Gene ID | 54448 |
mRNA Refseq | NM_019450 |
Protein Refseq | NP_062323 |
UniProt ID | Q9JLA2 |
◆ Recombinant Proteins | ||
Il1f6-382M | Recombinant Mouse Il1f6 protein(Met1-His160) | +Inquiry |
Il36a-3506M | Recombinant Mouse Il36a Protein, Myc/DDK-tagged | +Inquiry |
IL1F6-398H | Active Recombinant Human Interleukin 1 Family, Member 6 (Epsilon) | +Inquiry |
IL36A-7293H | Recombinant Human IL36A protein, His-tagged | +Inquiry |
Il1f6-552M | Active Recombinant Mouse Il1f6 | +Inquiry |
◆ Cell & Tissue Lysates | ||
IL36A-5238HCL | Recombinant Human IL1F6 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All IL36A Products
Required fields are marked with *
My Review for All IL36A Products
Required fields are marked with *
0
Inquiry Basket