Species : |
Mouse |
Source : |
E.coli |
Tag : |
Non |
Protein Length : |
160 |
Description : |
Interleukin-36 (IL-36) is a pro-inflammatory cytokine which plays an important role in the pathophysiology of several diseases. IL-36α, IL-36β, and IL-36γ (formerly IL-1F6, IL-1F8, and IL-1F9) are IL-1 family members that signal through the IL-1 receptor family members IL-1Rrp2 (IL-1RL2) and IL-1RAcP. IL-36α is mainly found in skin and lymphoid tissues, but also in fetal brain, trachea, stomach and intestine. It is expressed by monocytes, B and T cells. Notably, IL-36 alpha is the only novel IL-1 family member expressed on T-cells. Recombinant murine interleukin-36 alpha contains 160 amino acids residues which is a single non-glycosylated polypeptide. Specifically, mouse IL-36α shares 83 % a.a. sequence identity with rat IL-36α, 54-60 % with human, rabbit, equine and bovine IL-36α. |
Form : |
Lyophilized from a 0.2μm filtered concentrated solution in PBS, pH 7.4, 5 % trehalose. |
Bio-activity : |
Fully biologically active when compared to standard. The specific activity determined by its ability in a functional ELISA. Immobilized rMuIL-36α at 1 µg/mL can bind recombinant murine IL-1 Rrp2 with a range of 0.15-5 µg/mL. |
Molecular Mass : |
Approximately 18.0 kDa, a single non-glycosylated polypeptide chain containing 160 amino acids. |
AA Sequence : |
MNKEKELRAASPSLRHVQDLSSRVWILQNNILTAVPRKEQTVPVTITLLPCQYLDTLETNRGDPTYMGVQRPMSCLFCTKDGEQPVLQLGEGNIMEMYNKKEPVKASLFYHKKSGTTSTFESAAFPGWFIAVCSKGSCPLILTQELGEIFITDFEMIVVH |
Endotoxin : |
Less than 1 EU/μg of rMuIL-36α, 160a.a. as determined by LAL method. |
Purity : |
>95% by SDS-PAGE and HPLC analysis. |
Storage : |
Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution. |
Reconstitution : |
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions. |