| Species : | Human | 
                                
                                    | Source : | E.coli | 
                                
                                    | Tag : | Non | 
                                
                                    | Protein Length : | 157 | 
                                
                                    | Description : | Interleukin-36 (IL-36) is a pro-inflammatory cytokine which plays an important role in the pathophysiology of several diseases. IL-36α, IL-36β, and IL-36γ (formerly IL-1F6, IL-1F8, and IL-1F9) are IL-1 family members that signal through the IL-1 receptor family members IL-1Rrp2 (IL-1RL2) and IL-1RAcP. IL-36 beta is reported to be expressed at higher levels in psoriatic plaques than in symptomless psoriatic skin or healthy control skin. Furthermore, it can stimulate production of interleukin-6 and interleukin-8 in synovial fibroblasts, articular chondrocytes and mature adipocytes. Two alternatively spliced transcript variants encode distinct (164 or 157 residues) protein isoforms that differ in their C-terminal 70 amino acid residues have been reported and IL-36β isoform 2 is synthesized as a 157 a.a. protein. Specifically, human IL-36β shares low sequence identity with IL-1β, IL-36RA, IL-36α and IL-36γ. | 
                                
                                    | Form : | Lyophilized from a 0.2μm filtered concentrated solution in PBS, pH 7.4. | 
                                
                                    | Bio-activity  : | Fully biologically active when compared to standard. The specific activity is determined by its binding ability in a functional ELISA. Immobilized rHuIL-36β at 1 µg/mL can bind recombinant human IL-1 Rrp2 Fc Chimera with a range of 0.15-5 µg/mL. | 
                                
                                    | Molecular Mass : | Approximately 17.7kDa, a single non-glycosylated polypeptide chain containing 157 amino acids. | 
                                
                                    | AA Sequence : | MNPQREAAPKSYAIRDSRQMVWVLSGNSLIAAPLSRSIKPVTLHLIACRDTEFSDKEKGNMVYLGIKGKDLCLFCAEIQGKPTLQLKEKNIMDLYVEKKAQKPFLFFHNKEGSTSVFQSVSYPGWFIATSTTSGQPIFLTKERGITNNTNFYLDSVE | 
                                
                                    | Endotoxin : | Less than 1 EU/μg of rHuIL-36β, 157a.a. as determined by LAL method. | 
                                
                                    | Purity : | >97% by SDS-PAGE and HPLC analysis. | 
                                
                                    | Storage : | Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution. | 
                                
                                    | Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions. |