Recombinant Human IL36G protein
| Cat.No. : | IL36G-511H |
| Product Overview : | Recombinant Human IL36G protein (Interleukin-36 gamma, 152a.a.) was expressed in Escherichia coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | Non |
| Protein Length : | 152 |
| Description : | Interleukin-36 (IL-36) is a pro-inflammatory cytokine which plays an important role in the pathophysiology of several diseases. IL-36α, IL-36β, and IL-36γ (formerly IL-1F6, IL-1F8, and IL-1F9) are IL-1 family members that signal through the IL-1 receptor family members IL-1Rrp2 (IL-1RL2) and IL-1RAcP. IL-36γ is secreted when transfected into 293-T cells and it could constitute part of an independent signaling system analogous to interleukin-1 alpha (IL-1A), beta (IL-1B) receptor agonist and interleukin-1 receptor type I (IL-1R1). Furthermore, IL-36γ also can function as an agonist of NF-kappa B activation through the orphan IL-1-receptor-related protein 2. Human IL-36γ (152a.a) shares 58 %, 59 %, 68 % and 69 % a.a. sequence identity with mouse, rat, bovine and equine IL-36γ, respectively, and 23 - 57% a.a. sequence identity with other family members. |
| Form : | Lyophilized from a 0.2μm filtered concentrated solution in PBS, pH 7.4. |
| Bio-activity : | Fully biologically active when compared to standard. The ED50 as determined by its ability to induce IL-8 secretion by human preadipocytes is less than 10 ng/ml, corresponding to a specific activity of > 1 × 10⁵ IU/mg. |
| Molecular Mass : | Approximately 17.0 kDa, a single non-glycosylated polypeptide chain containing 152 amino acids. |
| AA Sequence : | SMCKPITGTINDLNQQVWTLQGQNLVAVPRSDSVTPVTVAVITCKYPEALEQGRGDPIYLGIQNPEMCLYCEKVGEQPTLQLKEQKIMDLYGQPEPVKPFLFYRAKTGRTSTLESVAFPDWFIASSKRDQPIILTSELGKSYNTAFELNIND |
| Endotoxin : | Less than 1 EU/μg of rHuIL-36γ, 152a.a. as determined by LAL method. |
| Purity : | >95% by SDS-PAGE and HPLC analysis. |
| Storage : | Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution. |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20centigrade. Further dilutions should be made in appropriate buffered solutions. |
| Gene Name | IL36G |
| Official Symbol | IL36G |
| Synonyms | IL36G; interleukin 36, gamma; IL1F9, interleukin 1 family, member 9; interleukin-36 gamma; IL 1F9; IL 1H1; IL 1RP2; IL1E; IL1H1; interleukin 1 related protein 2; interleukin 1 epsilon; interleukin 1 homolog 1; IL-1 epsilon; IL-1-epsilon; IL-1(EPSILON); interleukin-1 epsilon; IL-1 related protein 2; IL-1-related protein 2; interleukin-1 homolog 1; interleukin-1 family member 9; interleukin 1 family, member 9; interleukin 1-related protein 2; IL1F9; IL-1F9; IL-1H1; IL1RP2; IL-1RP2; |
| Gene ID | 56300 |
| mRNA Refseq | NM_019618 |
| Protein Refseq | NP_062564 |
| MIM | 605542 |
| UniProt ID | Q9NZH8 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All IL36G Products
Required fields are marked with *
My Review for All IL36G Products
Required fields are marked with *



