Recombinant Human IL36G Protein
Cat.No. : | IL36G-85H |
Product Overview : | Recombinant Human Interleukin-36 gamma is produced by our E.coli expression system and the target gene encoding Ser18-Asp169 is expressed. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Protein Length : | Ser18-Asp169 |
Description : | Interleukin-36 gamma (IL-36γ) is a member of the interleukin 1 cytokine family that includes three closely related genes, IL-36α, β, and γ, formerly known as IL-1F6, F8, and F9 respectively. IL-36α has been detected in both neuronal and synovial tissue, whereas IL-36β and IL-36γ are expressed in both cutaneous and mucosal epithelial cells, including the respiratory tract. IL-36β and IL-36γ stimulate proliferation, maturation and/or cytokine expression by innate immune cells (such as keratinocytes and dendritic cells), and adaptive immune cells (neutrophils and T-cells) in both humans and mice. The activity of IL-36α is mediated by interleukin 1 receptor-like 2 (IL1RL2/IL1R-rp2), and is specifically inhibited by interleukin 1 family, member 5 (IL1F5/IL-1 delta). IL-36γ plays an important role in communicating the cell death to surrounding cells. |
Form : | Lyophilized from a 0.2 um filtered solution of 20mM Tris,100mM Nacl, 0.1mM EDTA, pH8.0. |
AA Sequence : | SMCKPITGTINDLNQQVWTLQGQNLVAVPRSDSVTPVTVAVITCKYPEALEQGRGDPIYLGIQNPEMCL YCEKVGEQPTLQLKEQKIMDLYGQPEPVKPFLFYRAKTGRTSTLESVAFPDWFIASSKRDQPIILTSELG KSYNTAFELNIND |
Endotoxin : | Less than 0.1 ng/ug (1 EU/ug). |
Purity : | >95% |
Storage : | Lyophilized protein should be stored at < -20 centigrade, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7 centigrade for 2-7 days. Aliquots of reconstituted samples are stable at < -20 centigrade for 3 months. |
Quality Statement : | Purity: Greater than 95% as determined by reducing SDS-PAGE. |
Shipping : | The product is shipped at ambient temperature. Upon receipt, store it immediately at the temperature listed below. |
Gene Name | IL36G interleukin 36 gamma [ Homo sapiens (human) ] |
Official Symbol | IL36G |
Synonyms | Interleukin-36 gamma; IL36G; IL-1-related protein 2; IL-1 epsilon; Interleukin-1 homolog 1; IL1E; IL1F9; IL1H1; IL-1F9; IL-1H1; IL1RP2; IL-1RP2 |
Gene ID | 56300 |
mRNA Refseq | NM_019618.4 |
Protein Refseq | NP_062564.1 |
MIM | 605542 |
UniProt ID | Q9NZH8 |
◆ Recombinant Proteins | ||
IL36G-256H | Active Recombinant Human IL36G Protein (Ser18-Asp169), C-His tagged, Animal-free, Carrier-free | +Inquiry |
IL36G-141H | Active Recombinant Human IL36G protein | +Inquiry |
Il1f9-369M | Active Recombinant Mouse Il1f9, FLAG-tagged | +Inquiry |
IL36G-511H | Recombinant Human IL36G protein | +Inquiry |
IL36G-13H | Recombinant Human IL36G Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
IL36G-5235HCL | Recombinant Human IL1F9 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All IL36G Products
Required fields are marked with *
My Review for All IL36G Products
Required fields are marked with *
0
Inquiry Basket