Recombinant Human IL36G Protein, His-tagged
Cat.No. : | IL36G-13H |
Product Overview : | Recombinant human IL36B protein (1-169aa), fused to His-tag at N-terminus, was expressed in E. coli and purified by using conventional chromatography techniques. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-169 a.a. |
Description : | The protein encoded by this gene is a member of the interleukin 1 cytokine family. The activity of this cytokine is mediated by interleukin 1 receptor-like 2 (IL1RL2/IL1R-rp2), and is specifically inhibited by interleukin 1 family, member 5 (IL1F5/IL-1 delta). Interferon-gamma, tumor necrosis factor-alpha and interleukin 1, beta (IL1B) are reported to stimulate the expression of this cytokine in keratinocytes. The expression of this cytokine in keratinocytes can also be induced by a contact hypersensitivity reaction or herpes simplex virus infection. This gene and eight other interleukin 1 family genes form a cytokine gene cluster on chromosome 2. |
Form : | Liquid |
Molecular Mass : | 21.1 kDa confirmed by MALDI-TOF |
Identity : | 192aa |
AA Sequence : | MGSSHHHHHHSSGLVPRGSHMGSMRGTPGDADGGGRAVYQSMCKPITGTINDLNQQVWTLQGQNLVAVPRSDSVTPVTVAVITCKYPEALEQGRGDPIYLGIQNPEMCLYCEKVGEQPTLQLKEQKIMDLYGQPEPVKPFLFYRAKTGRTSTLESVAFPDWFIASSKRDQPIILTSELGKSYNTAFELNIND |
Endotoxin : | < 1 EU/μg of protein (determined by LAL method) |
Purity : | > 95% by SDS-PAGE |
Applications : | SDS-PAGE |
Storage : | Can be stored at 2 to 8 centigrade for 1 week. For long term storage, aliquot and store at -20 to -80 centigrade. Avoid repeated freezing and thawing cycles. |
Concentration : | 1 mg/mL (determined by BCA assay) |
Storage Buffer : | 20mM Tris-HCl buffer (pH 8.0) containing 0.15M NaCl, 10% glycerol |
Gene Name | IL36G interleukin 36 gamma [ Homo sapiens (human) ] |
Official Symbol | IL36G |
Synonyms | IL36G; interleukin 36 gamma; IL1E; IL1F9; IL1H1; IL-1F9; IL-1H1; IL1RP2; IL-1RP2; interleukin-36 gamma; IL-1 related protein 2; IL-1-epsilon; interleukin 1-related protein 2; interleukin-1 epsilon; interleukin-1 family member 9; interleukin-1 homolog 1 |
Gene ID | 56300 |
mRNA Refseq | NM_019618 |
Protein Refseq | NP_062564 |
MIM | 605542 |
UniProt ID | Q9NZH8 |
◆ Recombinant Proteins | ||
IL36G-13H | Recombinant Human IL36G Protein, His-tagged | +Inquiry |
IL36G-3654H | Recombinant Human IL36G protein, His-tagged | +Inquiry |
IL1F9-14173H | Recombinant Human IL1F9, GST-tagged | +Inquiry |
IL36G-5107H | Recombinant Human IL36G Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
IL36G-7516H | Recombinant Human IL36G protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
IL36G-5235HCL | Recombinant Human IL1F9 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All IL36G Products
Required fields are marked with *
My Review for All IL36G Products
Required fields are marked with *
0
Inquiry Basket