Recombinant Human IL36G Protein, His-tagged

• Cat.No.: IL36G-13H
• Product Overview: Recombinant human IL36B protein (1-169aa), fused to His-tag at N-terminus, was expressed in E. coli and purified by using conventional chromatography techniques.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 1-169 a.a.
• Description: The protein encoded by this gene is a member of the interleukin 1 cytokine family. The activity of this cytokine is mediated by interleukin 1 receptor-like 2 (IL1RL2/IL1R-rp2), and is specifically inhibited by interleukin 1 family, member 5 (IL1F5/IL-1 delta). Interferon-gamma, tumor necrosis factor-alpha and interleukin 1, beta (IL1B) are reported to stimulate the expression of this cytokine in keratinocytes. The expression of this cytokine in keratinocytes can also be induced by a contact hypersensitivity reaction or herpes simplex virus infection. This gene and eight other interleukin 1 family genes form a cytokine gene cluster on chromosome 2.
• Form: Liquid
• Molecular Mass: 21.1 kDa confirmed by MALDI-TOF
• Identity: 192aa
• AA Sequence: MGSSHHHHHHSSGLVPRGSHMGSMRGTPGDADGGGRAVYQSMCKPITGTINDLNQQVWTLQGQNLVAVPRSDSVTPVTVAVITCKYPEALEQGRGDPIYLGIQNPEMCLYCEKVGEQPTLQLKEQKIMDLYGQPEPVKPFLFYRAKTGRTSTLESVAFPDWFIASSKRDQPIILTSELGKSYNTAFELNIND
• Endotoxin: < 1 EU/μg of protein (determined by LAL method)
• Purity: > 95% by SDS-PAGE
• Applications: SDS-PAGE
• Storage: Can be stored at 2 to 8 centigrade for 1 week. For long term storage, aliquot and store at -20 to -80 centigrade. Avoid repeated freezing and thawing cycles.
• Concentration: 1 mg/mL (determined by BCA assay)
• Storage Buffer: 20mM Tris-HCl buffer (pH 8.0) containing 0.15M NaCl, 10% glycerol

Gene Information

• Gene Name: IL36G interleukin 36 gamma [ Homo sapiens (human) ]
• Official Symbol: IL36G
• Synonyms: IL36G; interleukin 36 gamma; IL1E; IL1F9; IL1H1; IL-1F9; IL-1H1; IL1RP2; IL-1RP2; interleukin-36 gamma; IL-1 related protein 2; IL-1-epsilon; interleukin 1-related protein 2; interleukin-1 epsilon; interleukin-1 family member 9; interleukin-1 homolog 1
• Gene ID: 56300
• mRNA Refseq: NM_019618
• Protein Refseq: NP_062564
• MIM: 605542
• UniProt ID: Q9NZH8