Recombinant Human IL36G Protein, His-tagged

Cat.No. : IL36G-13H
Product Overview : Recombinant human IL36B protein (1-169aa), fused to His-tag at N-terminus, was expressed in E. coli and purified by using conventional chromatography techniques.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 1-169 a.a.
Description : The protein encoded by this gene is a member of the interleukin 1 cytokine family. The activity of this cytokine is mediated by interleukin 1 receptor-like 2 (IL1RL2/IL1R-rp2), and is specifically inhibited by interleukin 1 family, member 5 (IL1F5/IL-1 delta). Interferon-gamma, tumor necrosis factor-alpha and interleukin 1, beta (IL1B) are reported to stimulate the expression of this cytokine in keratinocytes. The expression of this cytokine in keratinocytes can also be induced by a contact hypersensitivity reaction or herpes simplex virus infection. This gene and eight other interleukin 1 family genes form a cytokine gene cluster on chromosome 2.
Form : Liquid
Molecular Mass : 21.1 kDa confirmed by MALDI-TOF
Identity : 192aa
AA Sequence : MGSSHHHHHHSSGLVPRGSHMGSMRGTPGDADGGGRAVYQSMCKPITGTINDLNQQVWTLQGQNLVAVPRSDSVTPVTVAVITCKYPEALEQGRGDPIYLGIQNPEMCLYCEKVGEQPTLQLKEQKIMDLYGQPEPVKPFLFYRAKTGRTSTLESVAFPDWFIASSKRDQPIILTSELGKSYNTAFELNIND
Endotoxin : < 1 EU/μg of protein (determined by LAL method)
Purity : > 95% by SDS-PAGE
Applications : SDS-PAGE
Storage : Can be stored at 2 to 8 centigrade for 1 week. For long term storage, aliquot and store at -20 to -80 centigrade. Avoid repeated freezing and thawing cycles.
Concentration : 1 mg/mL (determined by BCA assay)
Storage Buffer : 20mM Tris-HCl buffer (pH 8.0) containing 0.15M NaCl, 10% glycerol
Gene Name IL36G interleukin 36 gamma [ Homo sapiens (human) ]
Official Symbol IL36G
Synonyms IL36G; interleukin 36 gamma; IL1E; IL1F9; IL1H1; IL-1F9; IL-1H1; IL1RP2; IL-1RP2; interleukin-36 gamma; IL-1 related protein 2; IL-1-epsilon; interleukin 1-related protein 2; interleukin-1 epsilon; interleukin-1 family member 9; interleukin-1 homolog 1
Gene ID 56300
mRNA Refseq NM_019618
Protein Refseq NP_062564
MIM 605542
UniProt ID Q9NZH8

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All IL36G Products

Required fields are marked with *

My Review for All IL36G Products

Required fields are marked with *

0
cart-icon
0
compare icon