Recombinant Human IL36G Protein, His-tagged
| Cat.No. : | IL36G-13H |
| Product Overview : | Recombinant human IL36B protein (1-169aa), fused to His-tag at N-terminus, was expressed in E. coli and purified by using conventional chromatography techniques. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 1-169 a.a. |
| Description : | The protein encoded by this gene is a member of the interleukin 1 cytokine family. The activity of this cytokine is mediated by interleukin 1 receptor-like 2 (IL1RL2/IL1R-rp2), and is specifically inhibited by interleukin 1 family, member 5 (IL1F5/IL-1 delta). Interferon-gamma, tumor necrosis factor-alpha and interleukin 1, beta (IL1B) are reported to stimulate the expression of this cytokine in keratinocytes. The expression of this cytokine in keratinocytes can also be induced by a contact hypersensitivity reaction or herpes simplex virus infection. This gene and eight other interleukin 1 family genes form a cytokine gene cluster on chromosome 2. |
| Form : | Liquid |
| Molecular Mass : | 21.1 kDa confirmed by MALDI-TOF |
| Identity : | 192aa |
| AA Sequence : | MGSSHHHHHHSSGLVPRGSHMGSMRGTPGDADGGGRAVYQSMCKPITGTINDLNQQVWTLQGQNLVAVPRSDSVTPVTVAVITCKYPEALEQGRGDPIYLGIQNPEMCLYCEKVGEQPTLQLKEQKIMDLYGQPEPVKPFLFYRAKTGRTSTLESVAFPDWFIASSKRDQPIILTSELGKSYNTAFELNIND |
| Endotoxin : | < 1 EU/μg of protein (determined by LAL method) |
| Purity : | > 95% by SDS-PAGE |
| Applications : | SDS-PAGE |
| Storage : | Can be stored at 2 to 8 centigrade for 1 week. For long term storage, aliquot and store at -20 to -80 centigrade. Avoid repeated freezing and thawing cycles. |
| Concentration : | 1 mg/mL (determined by BCA assay) |
| Storage Buffer : | 20mM Tris-HCl buffer (pH 8.0) containing 0.15M NaCl, 10% glycerol |
| Gene Name | IL36G interleukin 36 gamma [ Homo sapiens (human) ] |
| Official Symbol | IL36G |
| Synonyms | IL36G; interleukin 36 gamma; IL1E; IL1F9; IL1H1; IL-1F9; IL-1H1; IL1RP2; IL-1RP2; interleukin-36 gamma; IL-1 related protein 2; IL-1-epsilon; interleukin 1-related protein 2; interleukin-1 epsilon; interleukin-1 family member 9; interleukin-1 homolog 1 |
| Gene ID | 56300 |
| mRNA Refseq | NM_019618 |
| Protein Refseq | NP_062564 |
| MIM | 605542 |
| UniProt ID | Q9NZH8 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All IL36G Products
Required fields are marked with *
My Review for All IL36G Products
Required fields are marked with *
Recently Viewed
