Recombinant Human IL3RA, Fc-tagged
| Cat.No. : | IL3RA-29795TH |
| Product Overview : | Recombinant fragment, corresponding to amino acids 19-302 of Human IL3RA fused to the Fc region of human IgG1 expressed in modified human 293 cells, 533 amino acids, Predicted MWt 60.6 kDa. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Tag : | Fc |
| Protein Length : | 19-302 a.a. |
| Description : | The protein encoded by this gene is an interleukin 3 specific subunit of a heterodimeric cytokine receptor. The receptor is comprised of a ligand specific alpha subunit and a signal transducing beta subunit shared by the receptors for interleukin 3 (IL3), colony stimulating factor 2 (CSF2/GM-CSF), and interleukin 5 (IL5). The binding of this protein to IL3 depends on the beta subunit. The beta subunit is activated by the ligand binding, and is required for the biological activities of IL3. This gene and the gene encoding the colony stimulating factor 2 receptor alpha chain (CSF2RA) form a cytokine receptor gene cluster in a X-Y pseudoautosomal region on chromosomes X or Y. |
| Conjugation : | Fc |
| Form : | Lyophilised:It is recommended that 0.5 ml of sterile phosphate-buffered saline be added to the vial. Following reconstitution short-term storage at 4°C is recommended, and longer-term storage of aliquots at -18 to -20°C. Repeated freeze thawing is not rec |
| Purity : | >95% by SDS-PAGE |
| Storage buffer : | Preservative: NoneConstituents: 10% Trehalose, 1% Human serum albumin |
| Storage : | Store at +4°C. |
| Sequences of amino acids : | TKEDPNPPITNLRMKAKAQQLTWDLNRNVTDIECVKDADY SMPAVNNSYCQFGAISLCEVTNYTVRVANPPFSTWILF PENSGKPWAGAENLTCWIHDVDFLSCSWAVGPGAPADV QYDLYLNVANRRQQYECLHYKTDAQGTRIGCRFDDISR LSSGSQSSHILVRGRSAAFGIPCTDKFVVFSQIEILTP PNMTAKCNKTHSFMHWKMRSHFNRKFRYELQIQKRMQPVITEQVRDRTSFQLLNPGTYTVQIRARERVYEFLSAWSTP QRFECDQEEGANTRGGRVDGIQWIPKVDKKVEPKSCDK THTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVT CVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNS TYRVVSVLTVLHQDWLNGKEYKCRVSNKALPAPIEKTI SKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDK SRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK |
| Sequence Similarities : | Belongs to the type I cytokine receptor family. Type 5 subfamily. |
| Gene Name | IL3RA interleukin 3 receptor, alpha (low affinity) [ Homo sapiens ] |
| Official Symbol | IL3RA |
| Synonyms | IL3RA; interleukin 3 receptor, alpha (low affinity); interleukin-3 receptor subunit alpha; CD123; |
| Gene ID | 3563 |
| mRNA Refseq | NM_002183 |
| Protein Refseq | NP_002174 |
| MIM | 308385 |
| Uniprot ID | P26951 |
| Chromosome Location | Xp22.3 and Yp13.3 |
| Pathway | Apoptosis, organism-specific biosystem; Apoptosis, conserved biosystem; Cytokine Signaling in Immune system, organism-specific biosystem; Cytokine-cytokine receptor interaction, organism-specific biosystem; Cytokine-cytokine receptor interaction, conserved biosystem; |
| Function | interleukin-3 receptor activity; receptor activity; |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All IL3RA Products
Required fields are marked with *
My Review for All IL3RA Products
Required fields are marked with *
