Recombinant Human IL3RA Protein, Fc-tagged, FITC conjugated
Cat.No. : | IL3RA-29795THF |
Product Overview : | FITC conjugated recombinant fragment, corresponding to amino acids 19-302 of Human IL3RA fused to the Fc region of human IgG1 expressed in modified human 293 cells, 533 amino acids, Predicted MWt 60.6 kDa. |
Availability | September 07, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | Fc |
Protein Length : | 19-302 a.a. |
Description : | The protein encoded by this gene is an interleukin 3 specific subunit of a heterodimeric cytokine receptor. The receptor is comprised of a ligand specific alpha subunit and a signal transducing beta subunit shared by the receptors for interleukin 3 (IL3), colony stimulating factor 2 (CSF2/GM-CSF), and interleukin 5 (IL5). The binding of this protein to IL3 depends on the beta subunit. The beta subunit is activated by the ligand binding, and is required for the biological activities of IL3. This gene and the gene encoding the colony stimulating factor 2 receptor alpha chain (CSF2RA) form a cytokine receptor gene cluster in a X-Y pseudoautosomal region on chromosomes X or Y. |
Form : | Lyophilized |
N-terminal Sequence Analysis : | TKEDPNPPITNLRMKAKAQQLTWDLNRNVTDIECVKDADY SMPAVNNSYCQFGAISLCEVTNYTVRVANPPFSTWILF PENSGKPWAGAENLTCWIHDVDFLSCSWAVGPGAPADV QYDLYLNVANRRQQYECLHYKTDAQGTRIGCRFDDISR LSSGSQSSHILVRGRSAAFGIPCTDKFVVFSQIEILTP PNMTAKCNKTHSFMHWKMRSHFNRKFRYELQIQKRMQPVITEQVRDRTSFQLLNPGTYTVQIRARERVYEFLSAWSTP QRFECDQEEGANTRGGRVDGIQWIPKVDKKVEPKSCDK THTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVT CVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNS TYRVVSVLTVLHQDWLNGKEYKCRVSNKALPAPIEKTI SKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDK SRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK |
Purity : | > 95 % as determined by SDS-PAGE |
Characteristic : | Disulfide-linked homodimer Labeled with FITC via amines Excitation source: 488 nm spectral line, argon-ion laser Excitation Wavelength: 488 nm Emission Wavelength: 535 nm |
Storage : | Store at +4 centigrade. |
Storage Buffer : | 10% Trehalose, 1% Human serum albumin |
Reconstitution : | It is recommended that 0.5 mL of sterile phosphate-buffered saline be added to the vial. Following reconstitution short-term storage at 4 centigrade is recommended, with longer-term storage in aliquots at -18 to -20 centigrade. Repeated freeze thawing is not recommended. |
Conjugation : | FITC |
Gene Name | IL3RA interleukin 3 receptor, alpha (low affinity) [ Homo sapiens ] |
Official Symbol | IL3RA |
Synonyms | IL3RA; interleukin 3 receptor, alpha (low affinity); interleukin-3 receptor subunit alpha; CD123; |
Gene ID | 3563 |
mRNA Refseq | NM_002183 |
Protein Refseq | NP_002174 |
MIM | 308385 |
UniProt ID | P26951 |
◆ Recombinant Proteins | ||
IL3RA-29795THAF488 | Recombinant Human IL3RA Protein, Fc-tagged, Alexa Fluor 488 conjugated | +Inquiry |
Il3ra-918M | Recombinant Mouse Il3ra Protein, Fc-tagged | +Inquiry |
IL3RA-1556R | Recombinant Rhesus Monkey IL3RA Protein | +Inquiry |
IL3RA-4278H | Recombinant Human IL3RA Protein (Met1-Arg305), C-His tagged | +Inquiry |
IL3RA-702HFL | Recombinant Full Length Human IL3RA Protein, C-Flag-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
IL3RA-742CCL | Recombinant Canine IL3RA cell lysate | +Inquiry |
IL3RA-2433HCL | Recombinant Human IL3RA cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All IL3RA Products
Required fields are marked with *
My Review for All IL3RA Products
Required fields are marked with *