Recombinant Human IL4, His-tagged
| Cat.No. : | IL4-14204H |
| Product Overview : | Recombinant Human IL4 protein(NP_000580.1)(24-153 aa), fused to His-tag, was expressed in E.coli and purified by GSH-sepharose. |
| Availability | December 19, 2025 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 24-153 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.). 5 % trehalose and 5 % mannitol are added as protectants before lyophilization. |
| AA Sequence : | GHKCDITLQEIIKTLNSLTEQKTLCTELTVTDIFAASKNTTEKETFCRAATVLRQFYSHHEKDTRCLGATAQQFHRHKQLIRFLKRLDRNLWGLAGLNSCPVKEANQSTLENFLERLKTIMREKYSKCSS |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage (see Stability and Storage for more details). If a different concentration is needed for your purposes please adjust the reconstitution volume as required (please note: the ion concentration of the final solution will vary according to the volume used). Note: Centrifuge vial before opening. When reconstituting, gently pipet and wash down the sides of the vial to ensure full recovery of the protein into solution. |
| Gene Name | IL4 interleukin 4 [ Homo sapiens ] |
| Official Symbol | IL4 |
| Synonyms | IL4; interleukin 4; interleukin-4; B cell growth factor 1; B_cell stimulatory factor 1; BCGF 1; BCGF1; BSF1; IL 4; lymphocyte stimulatory factor 1; MGC79402; binetrakin; pitrakinra; IL-4; BSF-1; BCGF-1; |
| Gene ID | 3565 |
| mRNA Refseq | NM_000589.2 |
| Protein Refseq | NP_000580.1 |
| MIM | 147780 |
| UniProt ID | P05112 |
| ◆ Recombinant Proteins | ||
| IL4-313H | Active Recombinant Human IL4, Fc-tagged | +Inquiry |
| IL4-08H | Active Recombinant Human IL4 Protein, Pre-aliquoted | +Inquiry |
| Il4-489M | Active Recombinant Mouse Il4 protein, His-tagged | +Inquiry |
| IL4-2317C | Recombinant Cattle IL4 Protein, His-tagged | +Inquiry |
| IL4-202H | Recombinant Human IL4 protein, His-Avi-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| IL4-001MCL | Recombinant Mouse IL4 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All IL4 Products
Required fields are marked with *
My Review for All IL4 Products
Required fields are marked with *
