Recombinant Human IL4 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : IL4-3924H
Product Overview : IL4 MS Standard C13 and N15-labeled recombinant protein (NP_000580) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : The protein encoded by this gene is a pleiotropic cytokine produced by activated T cells. This cytokine is a ligand for interleukin 4 receptor. The interleukin 4 receptor also binds to IL13, which may contribute to many overlapping functions of this cytokine and IL13. STAT6, a signal transducer and activator of transcription, has been shown to play a central role in mediating the immune regulatory signal of this cytokine. This gene, IL3, IL5, IL13, and CSF2 form a cytokine gene cluster on chromosome 5q, with this gene particularly close to IL13. This gene, IL13 and IL5 are found to be regulated coordinately by several long-range regulatory elements in an over 120 kilobase range on the chromosome. Two alternatively spliced transcript variants of this gene encoding distinct isoforms have been reported.
Molecular Mass : 17.49 kDa
AA Sequence : MGLTSQLLPPLFFLLACAGNFVHGHKCDITLQEIIKTLNSLTEQKTLCTELTVTDIFAASKNTTEKETFCRAATVLRQFYSHHEKDTRCLGATAQQFHRHKQLIRFLKRLDRNLWGLAGLNSCPVKEANQSTLENFLERLKTIMREKYSKCSSTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name IL4 interleukin 4 [ Homo sapiens (human) ]
Official Symbol IL4
Synonyms IL4; interleukin 4; interleukin-4; B cell growth factor 1; B_cell stimulatory factor 1; BCGF 1; BCGF1; BSF1; IL 4; lymphocyte stimulatory factor 1; MGC79402; binetrakin; pitrakinra; IL-4; BSF-1; BCGF-1;
Gene ID 3565
mRNA Refseq NM_000589
Protein Refseq NP_000580
MIM 147780
UniProt ID P05112

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All IL4 Products

Required fields are marked with *

My Review for All IL4 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon