Species : |
Human |
Source : |
Nicotiana Benthamiana |
Tag : |
His |
Protein Length : |
30-212 a.a. |
Description : |
Recombinant human Interleukin-6 is an important pro-inflammatory and anti-inflammatory cytokine expressed by many types cell including: T and B cells, macrophages, endothelial cells, fibroblasts, monocytes, keratinocytes and certain tumour cells. It is a multifunctional cytokine that modulates several physiologic processes such as haematopoiesis, stimulation of immunoglobulin synthesis, maturation and activation of B cells, differentiation of T lymphocytes and regulation of the hepatic acute-phase response. IL-6 is also produced in muscle, is discharged into the bloodstream after muscle contraction and acts increasing the breakdown of fats and improving insulin resistance. IL-6 induces signalling through a cell surface heterodimeric receptor complex composed of a ligand binding subunit (IL-6 R) and a signal transducing subunit (gp130). IL-6 binds to IL-6 R, triggering IL-6 R association with gp130 and gp130 dimerization. Soluble forms of IL-6 R are generated by both alternate splicing and proteolytic cleavage. In a mechanism known as trans-signalling, complexes of soluble IL-6 and IL-6 R elicit responses from gp130-expressing cells that lack cell surface IL-6 R. Trans-signalling enables a wider range of cell types to respond to IL-6, as the expression of gp130 is ubiquitous, while that of IL-6 R is predominantly restricted to hepatocytes, leukocytes, and lymphocytes. |
Form : |
Recombinant human IL-6 is lyophilized from 10mM Phosphate Potasium buffer pH 7.4 and 50mM NaCl. |
Molecular Mass : |
Predicted molecular mass of 22.2 kDa, could migrate with an apparent molecular mass of 23-24 kDa in SDS-PAGE gel. |
AA Sequence : |
HHHHHHHHHHVPPGEDSKDVAAPHRQPLTSSERIDKQIRYILDGISALRKETCNKSNMCESSKEALAENNLNLPK MAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDP TTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM |
Endotoxin : |
< 0.04="" eu/μg="" protein="" (lal=""> |
Purity : |
>97% by SDS-PAGE gel |
Storage : |
This lyophilized preparation is stable at 2-8o C for short term, long storage it should be kept at -20oC. Reconstituted protein should be stored in working aliquots at –20°C. Repeated freezing and thawing is not recommended. |
Reconstitution : |
Centrifuge vial before opening. Lyophilized protein should be reconstituted in water to a concentration of 50 ng/μl. Optimal concentration should be determined for specific application and cell lines. |