Recombinant Human IL6 protein, His-tagged
Cat.No. : | IL6-1105H |
Product Overview : | Recombinant Human IL6 protein(60-212 aa), fused with N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 60-212 aa |
Tag : | N-His |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 μg/μl in 200 μl sterile water for short-term storage. After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage. |
AA Sequence : | ILDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM |
Gene Name | IL6 interleukin 6 (interferon, beta 2) [ Homo sapiens ] |
Official Symbol | IL6 |
Synonyms | IL6; interleukin 6 (interferon, beta 2); IFNB2; interleukin-6; BSF2; HGF; HSF; IL 6; CDF; BSF-2; IFN-beta-2; interferon beta-2; interleukin BSF-2; hybridoma growth factor; CTL differentiation factor; B-cell stimulatory factor 2; B-cell differentiation factor; IL-6; |
Gene ID | 3569 |
mRNA Refseq | NM_000600 |
Protein Refseq | NP_000591 |
MIM | 147620 |
UniProt ID | P05231 |
◆ Recombinant Proteins | ||
ACSL3-197H | Recombinant Human ACSL3 Protein, GST-tagged | +Inquiry |
RFL-34899HF | Recombinant Full Length Human Long-Chain-Fatty-Acid--Coa Ligase 3(Acsl3) Protein, His-Tagged | +Inquiry |
ACSL3-789HF | Recombinant Full Length Human ACSL3 Protein, GST-tagged | +Inquiry |
ACSL3-1226M | Recombinant Mouse ACSL3 Protein | +Inquiry |
Acsl3-9319M | Recombinant Mouse Acsl3, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ACSL3-9076HCL | Recombinant Human ACSL3 293 Cell Lysate | +Inquiry |
ACSL3-9077HCL | Recombinant Human ACSL3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ACSL3 Products
Required fields are marked with *
My Review for All ACSL3 Products
Required fields are marked with *
0
Inquiry Basket