Recombinant Human IL6ST

Cat.No. : IL6ST-26366TH
Product Overview : Recombinant fragment, corresponding to amino acids 23-122 of Human CD130 , with an N-terminal proprietary tag, 36.63 kDa inclusive of tag
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 100 amino acids
Description : The protein encoded by this gene is a signal transducer shared by many cytokines, including interleukin 6 (IL6), ciliary neurotrophic factor (CNTF), leukemia inhibitory factor (LIF), and oncostatin M (OSM). This protein functions as a part of the cytokine receptor complex. The activation of this protein is dependent upon the binding of cytokines to their receptors. vIL6, a protein related to IL6 and encoded by the Kaposi sarcoma-associated herpesvirus, can bypass the interleukin 6 receptor (IL6R) and directly activate this protein. Knockout studies in mice suggest that this gene plays a critical role in regulating myocyte apoptosis. Alternatively spliced transcript variants encoding distinct isoforms have been described. A related pseudogene has been identified on chromosome 17.
Molecular Weight : 36.630kDa inclusive of tags
Tissue specificity : Found in all the tissues and cell lines examined. Expression not restricted to IL6 responsive cells.
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : ELLDPCGYISPESPVVQLHSNFTAVCVLKEKCMDYFHVNANYIVWKTNHFTIPKEQYTIINRTASSVTFTDIASLNIQLTCNILTFGQLEQNVYGITIIS
Sequence Similarities : Belongs to the type I cytokine receptor family. Type 2 subfamily.Contains 5 fibronectin type-III domains.Contains 1 Ig-like C2-type (immunoglobulin-like) domain.
Gene Name IL6ST interleukin 6 signal transducer (gp130, oncostatin M receptor) [ Homo sapiens ]
Official Symbol IL6ST
Synonyms IL6ST; interleukin 6 signal transducer (gp130, oncostatin M receptor); interleukin-6 receptor subunit beta; CD130; GP130;
Gene ID 3572
mRNA Refseq NM_001190981
Protein Refseq NP_001177910
MIM 600694
Uniprot ID P40189
Chromosome Location 5q11.2
Pathway Adipogenesis, organism-specific biosystem; Androgen Receptor Signaling Pathway, organism-specific biosystem; Cytokine Signaling in Immune system, organism-specific biosystem; Cytokine-cytokine receptor interaction, organism-specific biosystem; Cytokine-cytokine receptor interaction, conserved biosystem;
Function ciliary neurotrophic factor receptor activity; ciliary neurotrophic factor receptor binding; growth factor binding; contributes_to growth factor binding; interleukin-27 receptor activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All IL6ST Products

Required fields are marked with *

My Review for All IL6ST Products

Required fields are marked with *

0
cart-icon
0
compare icon