Recombinant Human IL6ST
| Cat.No. : | IL6ST-26366TH |
| Product Overview : | Recombinant fragment, corresponding to amino acids 23-122 of Human CD130 , with an N-terminal proprietary tag, 36.63 kDa inclusive of tag |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | Non |
| Protein Length : | 100 amino acids |
| Description : | The protein encoded by this gene is a signal transducer shared by many cytokines, including interleukin 6 (IL6), ciliary neurotrophic factor (CNTF), leukemia inhibitory factor (LIF), and oncostatin M (OSM). This protein functions as a part of the cytokine receptor complex. The activation of this protein is dependent upon the binding of cytokines to their receptors. vIL6, a protein related to IL6 and encoded by the Kaposi sarcoma-associated herpesvirus, can bypass the interleukin 6 receptor (IL6R) and directly activate this protein. Knockout studies in mice suggest that this gene plays a critical role in regulating myocyte apoptosis. Alternatively spliced transcript variants encoding distinct isoforms have been described. A related pseudogene has been identified on chromosome 17. |
| Molecular Weight : | 36.630kDa inclusive of tags |
| Tissue specificity : | Found in all the tissues and cell lines examined. Expression not restricted to IL6 responsive cells. |
| Form : | Liquid |
| Purity : | Proprietary Purification |
| Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
| Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
| Sequences of amino acids : | ELLDPCGYISPESPVVQLHSNFTAVCVLKEKCMDYFHVNANYIVWKTNHFTIPKEQYTIINRTASSVTFTDIASLNIQLTCNILTFGQLEQNVYGITIIS |
| Sequence Similarities : | Belongs to the type I cytokine receptor family. Type 2 subfamily.Contains 5 fibronectin type-III domains.Contains 1 Ig-like C2-type (immunoglobulin-like) domain. |
| Gene Name | IL6ST interleukin 6 signal transducer (gp130, oncostatin M receptor) [ Homo sapiens ] |
| Official Symbol | IL6ST |
| Synonyms | IL6ST; interleukin 6 signal transducer (gp130, oncostatin M receptor); interleukin-6 receptor subunit beta; CD130; GP130; |
| Gene ID | 3572 |
| mRNA Refseq | NM_001190981 |
| Protein Refseq | NP_001177910 |
| MIM | 600694 |
| Uniprot ID | P40189 |
| Chromosome Location | 5q11.2 |
| Pathway | Adipogenesis, organism-specific biosystem; Androgen Receptor Signaling Pathway, organism-specific biosystem; Cytokine Signaling in Immune system, organism-specific biosystem; Cytokine-cytokine receptor interaction, organism-specific biosystem; Cytokine-cytokine receptor interaction, conserved biosystem; |
| Function | ciliary neurotrophic factor receptor activity; ciliary neurotrophic factor receptor binding; growth factor binding; contributes_to growth factor binding; interleukin-27 receptor activity; |
| ◆ Recombinant Proteins | ||
| IL6ST-0298H | Recombinant Human IL6ST protein | +Inquiry |
| IL6ST-1964R | Active Recombinant Rat IL6ST protein, His&mFc-tagged | +Inquiry |
| IL6ST-6434C | Recombinant Chicken IL6ST | +Inquiry |
| Il6st-173M | Recombinant Mouse Il6st protein, His-tagged | +Inquiry |
| IL6ST-1682H | Recombinant Human IL6ST | +Inquiry |
| ◆ Native Proteins | ||
| Il6st-48M | Active Recombinant Mouse Il6st Homodimer Protein, His tagged | +Inquiry |
| IL6ST-69H | Active Recombinant Human IL6ST Protein, His&Avi tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| IL6ST-935HCL | Recombinant Human IL6ST cell lysate | +Inquiry |
| IL6ST-946CCL | Recombinant Cynomolgus IL6ST cell lysate | +Inquiry |
| IL6ST-001MCL | Recombinant Mouse IL6ST cell lysate | +Inquiry |
| IL6ST-1882RCL | Recombinant Rat IL6ST cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All IL6ST Products
Required fields are marked with *
My Review for All IL6ST Products
Required fields are marked with *
