Recombinant Human IL7 Protein, GMP Grade, Animal-Free

Cat.No. : IL7-34HG
Product Overview : GMP Recombinant Human IL7 protein with out tag was expressed in E. coli and manufactured using animal-derived component free materials.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Protein Length : 152 amino acid
Description : IL-7 is a hematopoietic growth factor that primarily affects early B and T cells. Produced by thymic stromal cells, spleen cells and keratinocytes, IL-7 can also co-stimulate the proliferation of mature T cells in combination with other factors, such as ConA and IL-2.
Molecular Mass : 17.4 kDa
AA Sequence : DCDIEGKDGKQYESVLMVSIDQLLDSMKEIGSNCLNNEFNFFKRHICDANKEGMFLFRAARKLRQFLKMNSTGDFDLHLLKVSEGTTILLNCTGQVKGRKPAALGEAQPTKSLEENKSLKEQKKLNDLCFLKRLLQEIKTCWNKILMGTKEH
Purity : ≥ 98% by SDS-PAGE gel and HPLC analyses.
Gene Name IL7 interleukin 7 [ Homo sapiens (human) ]
Official Symbol IL7
Synonyms IL7; interleukin 7; interleukin-7; IL 7; IL-7;
Gene ID 3574
mRNA Refseq NM_000880
Protein Refseq NP_000871
MIM 146660
UniProt ID P13232

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All IL7 Products

Required fields are marked with *

My Review for All IL7 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon