Recombinant Human IL7 Protein, GMP Grade, Animal-Free

• Cat.No.: IL7-34HG
• Product Overview: GMP Recombinant Human IL7 protein with out tag was expressed in E. coli and manufactured using animal-derived component free materials.

Specification

• Species: Human
• Source: E.coli
• Protein Length: 152 amino acid
• Description: IL-7 is a hematopoietic growth factor that primarily affects early B and T cells. Produced by thymic stromal cells, spleen cells and keratinocytes, IL-7 can also co-stimulate the proliferation of mature T cells in combination with other factors, such as ConA and IL-2.
• Molecular Mass: 17.4 kDa
• AA Sequence: DCDIEGKDGKQYESVLMVSIDQLLDSMKEIGSNCLNNEFNFFKRHICDANKEGMFLFRAARKLRQFLKMNSTGDFDLHLLKVSEGTTILLNCTGQVKGRKPAALGEAQPTKSLEENKSLKEQKKLNDLCFLKRLLQEIKTCWNKILMGTKEH
• Purity: ≥ 98% by SDS-PAGE gel and HPLC analyses.

Gene Information

• Gene Name: IL7 interleukin 7 [ Homo sapiens (human) ]
• Official Symbol: IL7
• Synonyms: IL7; interleukin 7; interleukin-7; IL 7; IL-7
• Gene ID: 3574
• mRNA Refseq: NM_000880
• Protein Refseq: NP_000871
• MIM: 146660
• UniProt ID: P13232