Recombinant Human IL7 Protein, GMP Grade, Animal-Free
Cat.No. : | IL7-34HG |
Product Overview : | GMP Recombinant Human IL7 protein with out tag was expressed in E. coli and manufactured using animal-derived component free materials. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Protein Length : | 152 amino acid |
Description : | IL-7 is a hematopoietic growth factor that primarily affects early B and T cells. Produced by thymic stromal cells, spleen cells and keratinocytes, IL-7 can also co-stimulate the proliferation of mature T cells in combination with other factors, such as ConA and IL-2. |
Molecular Mass : | 17.4 kDa |
AA Sequence : | DCDIEGKDGKQYESVLMVSIDQLLDSMKEIGSNCLNNEFNFFKRHICDANKEGMFLFRAARKLRQFLKMNSTGDFDLHLLKVSEGTTILLNCTGQVKGRKPAALGEAQPTKSLEENKSLKEQKKLNDLCFLKRLLQEIKTCWNKILMGTKEH |
Purity : | ≥ 98% by SDS-PAGE gel and HPLC analyses. |
Gene Name | IL7 interleukin 7 [ Homo sapiens (human) ] |
Official Symbol | IL7 |
Synonyms | IL7; interleukin 7; interleukin-7; IL 7; IL-7; |
Gene ID | 3574 |
mRNA Refseq | NM_000880 |
Protein Refseq | NP_000871 |
MIM | 146660 |
UniProt ID | P13232 |
◆ Recombinant Proteins | ||
IL7-234I | Active Recombinant Human IL7 Protein, His-tagged | +Inquiry |
IL7-5695HF | Recombinant Full Length Human IL7 Protein, GST-tagged | +Inquiry |
Il7-77M | Recombinant Mouse Il7 protein | +Inquiry |
IL7-056H | Recombinant Human interleukin 7 Protein, His&Flag tagged | +Inquiry |
IL7-233H | Recombinant Human IL7 | +Inquiry |
◆ Cell & Tissue Lysates | ||
IL7-5223HCL | Recombinant Human IL7 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All IL7 Products
Required fields are marked with *
My Review for All IL7 Products
Required fields are marked with *
0
Inquiry Basket