Recombinant Human IL7 protein, His-SUMO-tagged
| Cat.No. : | IL7-2380H | 
| Product Overview : | Recombinant Human IL7 protein(P13232)(26-177aa), fused to N-terminal His-SUMO tag, was expressed in E. coli. | 
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human | 
| Source : | E.coli | 
| Tag : | His&SUMO | 
| Protein Length : | 26-177aa | 
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. | 
| Molecular Mass : | 33.4 kDa | 
| AA Sequence : | DCDIEGKDGKQYESVLMVSIDQLLDSMKEIGSNCLNNEFNFFKRHICDANKEGMFLFRAARKLRQFLKMNSTGDFDLHLLKVSEGTTILLNCTGQVKGRKPAALGEAQPTKSLEENKSLKEQKKLNDLCFLKRLLQEIKTCWNKILMGTKEH | 
| Purity : | Greater than 90% as determined by SDS-PAGE. | 
| Storage : | Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. | 
| Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference. | 
| Gene Name | IL7 interleukin 7 [ Homo sapiens ] | 
| Official Symbol | IL7 | 
| Synonyms | IL7; interleukin 7; interleukin-7; IL 7; IL-7; | 
| Gene ID | 3574 | 
| mRNA Refseq | NM_000880 | 
| Protein Refseq | NP_000871 | 
| MIM | 146660 | 
| UniProt ID | P13232 | 
| ◆ Recombinant Proteins | ||
| IL7-65H | Recombinant Human IL7, His-tagged | +Inquiry | 
| IL7-121H | Recombinant Human IL7 Protein, His-tagged | +Inquiry | 
| IL7-146H | Active Recombinant Human IL7 protein | +Inquiry | 
| IL7-01C | Recombinant Chicken IL7 Protein, His-tagged | +Inquiry | 
| Il7-233I | Active Recombinant Mouse Il7 Protein, His-tagged | +Inquiry | 
| ◆ Cell & Tissue Lysates | ||
| IL7-5223HCL | Recombinant Human IL7 293 Cell Lysate | +Inquiry | 
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All IL7 Products
Required fields are marked with *
My Review for All IL7 Products
Required fields are marked with *
 
  
        
    
       
                         
                             
            