Recombinant Human IL7 protein, His-SUMO-tagged
Cat.No. : | IL7-2380H |
Product Overview : | Recombinant Human IL7 protein(P13232)(26-177aa), fused to N-terminal His-SUMO tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 26-177aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 33.4 kDa |
AA Sequence : | DCDIEGKDGKQYESVLMVSIDQLLDSMKEIGSNCLNNEFNFFKRHICDANKEGMFLFRAARKLRQFLKMNSTGDFDLHLLKVSEGTTILLNCTGQVKGRKPAALGEAQPTKSLEENKSLKEQKKLNDLCFLKRLLQEIKTCWNKILMGTKEH |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | IL7 interleukin 7 [ Homo sapiens ] |
Official Symbol | IL7 |
Synonyms | IL7; interleukin 7; interleukin-7; IL 7; IL-7; |
Gene ID | 3574 |
mRNA Refseq | NM_000880 |
Protein Refseq | NP_000871 |
MIM | 146660 |
UniProt ID | P13232 |
◆ Recombinant Proteins | ||
Il7-01M | Active Recombinant Mouse Il7 Protein, His-Tagged | +Inquiry |
IL7-9011H | Active Recombinant Human IL7 | +Inquiry |
IL7-214H | Recombinant Active Human IL7 Protein, His-tagged(C-ter) | +Inquiry |
IL7-171H | Active Recombinant Human IL7 Protein (Asp26-His177), C-His tagged, Animal-free, Carrier-free | +Inquiry |
IL7-5170H | Recombinant Human IL7 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
IL7-5223HCL | Recombinant Human IL7 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All IL7 Products
Required fields are marked with *
My Review for All IL7 Products
Required fields are marked with *
0
Inquiry Basket