| Species : |
Human |
| Source : |
E.coli |
| Tag : |
Non |
| Protein Length : |
77 |
| Description : |
Interleukin-8 (IL-8) is encoded by the IL8 gene and produced by macrophages and other cell types such as epithelial cells. It is also synthesized by endothelial cells, which store IL-8 in their storage vesicles. There are many receptors capable to bind IL-8, the most affinity to IL-8 are receptors CXCR1, and CXCR2. As a member of the CXC chemokine family, function of IL-8 is the induction of chemotaxis in its target cells, like neutrophil granulocytes, basophils, and T-cells. IL-8 (72a.a.) has a 5-10-fold higher activity on neutrophil activation, compared to IL-8 (77a.a.). IL-8 is often associated with inflammation, it has been cited as a proinflammatory mediator in gingivitis and psoriasis. |
| Form : |
Lyophilized from a 0.2μm filtered concentrated solution in PBS, pH 7.4. |
| Bio-activity : |
Fully biologically active when compared to standard. The ED50 as determined by a chemotaxis bioassay using human CXCR2 transfected mouse BaF3 cells is less than 2 ng/ml, corresponding to a specific activity of > 5.0 × 10⁵ IU/mg. |
| Molecular Mass : |
Approximately 8.9 kDa, a single, non-glycosylated polypeptide chain containing 77 amino acids. |
| AA Sequence : |
AVLPRSAKELRCQCIKTYSKPFHPKFIKELRVIESGPHCANTEIIVKLSDGRELCLDPKENWVQRVVEKFLKRAENS |
| Endotoxin : |
Less than 1 EU/µg of rHuIL-8, 77a.a./CXCL8 as determined by LAL method. |
| Purity : |
>96% by SDS-PAGE and HPLC analysis. |
| Storage : |
Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution. |
| Reconstitution : |
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions. |