Recombinant Human IL9 protein, His-SUMO-tagged
| Cat.No. : | IL9-3566H |
| Product Overview : | Recombinant Human IL9 protein(P15248)(19-144aa), fused with N-terminal His and SUMO tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His&SUMO |
| Protein Length : | 19-144aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 27.1 kDa |
| Purity : | Greater than 85% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
| AA Sequence : | QGCPTLAGILDINFLINKMQEDPASKCHCSANVTSCLCLGIPSDNCTRPCFSERLSQMTNTTMQTRYPLIFSRVKKSVEVLKNNKCPYFSCEQPCNQTTAGNALTFLKSLLEIFQKEKMRGMRGKI |
| Gene Name | IL9 interleukin 9 [ Homo sapiens ] |
| Official Symbol | IL9 |
| Synonyms | IL9; interleukin 9; interleukin-9; homolog of mouse T cell and mast cell growth factor 40; HP40; IL 9; P40; p40 cytokine; p40 T cell and mast cell growth factor; T cell growth factor p40; cytokine P40; T-cell growth factor p40; p40 T-cell and mast cell growth factor; IL-9; |
| Gene ID | 3578 |
| mRNA Refseq | NM_000590 |
| Protein Refseq | NP_000581 |
| MIM | 146931 |
| UniProt ID | P15248 |
| ◆ Recombinant Proteins | ||
| Il9-2175M | Recombinant Mouse Il9 Protein | +Inquiry |
| IL9-374H | Recombinant Human IL9, His tagged | +Inquiry |
| IL9-003H | Active Recombinant Human IL9, MIgG2a Fc-tagged | +Inquiry |
| IL9-4292H | Recombinant Human IL9 Protein (Gln19-Ile144), C-His tagged | +Inquiry |
| IL9-173H | Active Recombinant Human IL9 Protein (Gln19-Ile144), N-His tagged, Animal-free, Carrier-free | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| IL9-618HCL | Recombinant Human IL9 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All IL9 Products
Required fields are marked with *
My Review for All IL9 Products
Required fields are marked with *



