Recombinant Human IL9 protein, His-SUMO-tagged

• Cat.No.: IL9-3566H
• Product Overview: Recombinant Human IL9 protein(P15248)(19-144aa), fused with N-terminal His and SUMO tag, was expressed in E.coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His&SUMO
• Protein Length: 19-144aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 27.1 kDa
• Purity: Greater than 85% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.
• AA Sequence: QGCPTLAGILDINFLINKMQEDPASKCHCSANVTSCLCLGIPSDNCTRPCFSERLSQMTNTTMQTRYPLIFSRVKKSVEVLKNNKCPYFSCEQPCNQTTAGNALTFLKSLLEIFQKEKMRGMRGKI

Gene Information

• Gene Name: IL9 interleukin 9 [ Homo sapiens ]
• Official Symbol: IL9
• Synonyms: IL9; interleukin 9; interleukin-9; homolog of mouse T cell and mast cell growth factor 40; HP40; IL 9; P40; p40 cytokine; p40 T cell and mast cell growth factor; T cell growth factor p40; cytokine P40; T-cell growth factor p40; p40 T-cell and mast cell growth factor; IL-9
• Gene ID: 3578
• mRNA Refseq: NM_000590
• Protein Refseq: NP_000581
• MIM: 146931
• UniProt ID: P15248