Recombinant Human IL9R Protein, C-His-tagged
| Cat.No. : | IL9R-072H |
| Product Overview : | Recombinant Human IL9R Protein with C-His tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Description : | Interleukin-9 (IL-9) functions to support the growth of helper T cells, megakaryoblastic leukemia cells, fetal thymocytes, erythroid and myeloid precursors and mast cells. The murine IL-9 receptor has been identified as a protein expressed on a T cell clone. Both the murine and human IL-9 receptor cDNAs have been isolated by expression cloning from the murine T cell clone TS1 and the human megakaryoblastic leukemia cell line MO7E, respectively. In addition, the cloning and analysis of the complete human IL-9 receptor genomic DNA has been reported. In this latter study, the IL-9R gene was shown to consist of 10 exons expressed over approximately 13.7 kb of DNA. |
| Molecular Mass : | ~25 kDa |
| AA Sequence : | SVTGEGQGPRSRTFTCLTNNILRIDCHWSAPELGQGSSPWLLFTSNQAPGGTHKCILRGSECTVVLPPEAVLVPSDNFTITFHHCMSGREQVSLVDPEYLPRRHVKLDPPSDLQSNISSGHCILTWSISPALEPMTTLLSYELAFKKQEEAWEQAQHRDHIVGVTWLILEAFELDPGFIHEARLRVQMATLEDDVVEEERYTGQWSEWSQPVCFQAPQRQGPLIPPWGWP |
| Purity : | Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is > 85% (by SDS-PAGE). |
| Notes : | For research use only, not for use in diagnostic procedure. |
| Storage : | Store at 4 centigrade short term. Aliquot and store at -20 centigrade long term. Avoid freeze-thaw cycles. |
| Concentration : | ≥0.5 mg/mL |
| Storage Buffer : | PBS, 4M Urea, pH7.4 |
| Gene Name | IL9R interleukin 9 receptor [ Homo sapiens (human) ] |
| Official Symbol | IL9R |
| Synonyms | IL9R; interleukin 9 receptor; interleukin-9 receptor; CD129; IL-9R; IL-9 receptor; |
| Gene ID | 3581 |
| mRNA Refseq | NM_002186 |
| Protein Refseq | NP_002177 |
| MIM | 300007 |
| UniProt ID | Q01113 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All IL9R Products
Required fields are marked with *
My Review for All IL9R Products
Required fields are marked with *



