Recombinant Human IL9R Protein, C-His-tagged

Species :	Human
Source :	E.coli
Tag :	His
Description :	Interleukin-9 (IL-9) functions to support the growth of helper T cells, megakaryoblastic leukemia cells, fetal thymocytes, erythroid and myeloid precursors and mast cells. The murine IL-9 receptor has been identified as a protein expressed on a T cell clone. Both the murine and human IL-9 receptor cDNAs have been isolated by expression cloning from the murine T cell clone TS1 and the human megakaryoblastic leukemia cell line MO7E, respectively. In addition, the cloning and analysis of the complete human IL-9 receptor genomic DNA has been reported. In this latter study, the IL-9R gene was shown to consist of 10 exons expressed over approximately 13.7 kb of DNA.
Molecular Mass :	~25 kDa
AA Sequence :	SVTGEGQGPRSRTFTCLTNNILRIDCHWSAPELGQGSSPWLLFTSNQAPGGTHKCILRGSECTVVLPPEAVLVPSDNFTITFHHCMSGREQVSLVDPEYLPRRHVKLDPPSDLQSNISSGHCILTWSISPALEPMTTLLSYELAFKKQEEAWEQAQHRDHIVGVTWLILEAFELDPGFIHEARLRVQMATLEDDVVEEERYTGQWSEWSQPVCFQAPQRQGPLIPPWGWP
Purity :	Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is > 85% (by SDS-PAGE).
Notes :	For research use only, not for use in diagnostic procedure.
Storage :	Store at 4 centigrade short term. Aliquot and store at -20 centigrade long term. Avoid freeze-thaw cycles.
Concentration :	≥0.5 mg/mL
Storage Buffer :	PBS, 4M Urea, pH7.4

Gene Name	IL9R interleukin 9 receptor [ Homo sapiens (human) ]
Official Symbol	IL9R
Synonyms	IL9R; interleukin 9 receptor; interleukin-9 receptor; CD129; IL-9R; IL-9 receptor;
Gene ID	3581
mRNA Refseq	NM_002186
Protein Refseq	NP_002177
MIM	300007
UniProt ID	Q01113