Recombinant Human ILDR2 Protein (1-186 aa), GST-tagged
| Cat.No. : | ILDR2-1045H |
| Product Overview : | Recombinant Human ILDR2 Protein (1-186 aa) is produced by E. coli expression system. This protein is fused with a GST tag at the N-terminal. Research Area: Immunology. Protein Description: Partial. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | 1-186 aa |
| Description : | May be involved in lipid homeostasis and ER stress pathways. |
| Form : | Tris-based buffer, 50% glycerol |
| Molecular Mass : | 48.1 kDa |
| AA Sequence : | MDRVLLRWISLFWLTAMVEGLQVTVPDKKKVAMLFQPTVLRCHFSTSSHQPAVVQWKFKSYCQDRMGESLGMSSTRAQSLSKRNLEWDPYLDCLDSRRTVRVVASKQGSTVTLGDFYRGREITIVHDADLQIGKLMWGDSGLYYCIITTPDDLEGKNEDSVELLVLGRTGLLADLLPSFAVEIMPE |
| Purity : | > 90% as determined by SDS-PAGE. |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
| Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
| Concentration : | A hardcopy of COA with concentration instruction is sent along with the products. |
| Gene Name | ILDR2 immunoglobulin-like domain containing receptor 2 [ Homo sapiens ] |
| Official Symbol | ILDR2 |
| Synonyms | C1orf32; dJ782G3.1; RP4-782G3.2; |
| Gene ID | 387597 |
| mRNA Refseq | NM_199351.2 |
| Protein Refseq | NP_955383.1 |
| UniProt ID | Q71H61 |
| ◆ Recombinant Proteins | ||
| ILDR2-3297Z | Recombinant Zebrafish ILDR2 | +Inquiry |
| ILDR2-1678H | Recombinant Human ILDR2 Protein (1-186 aa), His-tagged | +Inquiry |
| ILDR2-105H | Recombinant Human ILDR2(Leu21-Glu186) Protein, C-Fc-tagged | +Inquiry |
| ILDR2-102H | Recombinant Human ILDR2(Leu21-Glu186) Protein, C-6*His-tagged | +Inquiry |
| ILDR2-1045H | Recombinant Human ILDR2 Protein (1-186 aa), GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ILDR2 Products
Required fields are marked with *
My Review for All ILDR2 Products
Required fields are marked with *



