Recombinant Human ILDR2 Protein (1-186 aa), His-tagged
Cat.No. : | ILDR2-1678H |
Product Overview : | Recombinant Human ILDR2 Protein (1-186 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Research Area: Immunology. Protein Description: Partial. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Yeast |
Tag : | His |
Protein Length : | 1-186 aa |
Description : | May be involved in lipid homeostasis and ER stress pathways. |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 23.1 kDa |
AA Sequence : | MDRVLLRWISLFWLTAMVEGLQVTVPDKKKVAMLFQPTVLRCHFSTSSHQPAVVQWKFKSYCQDRMGESLGMSSTRAQSLSKRNLEWDPYLDCLDSRRTVRVVASKQGSTVTLGDFYRGREITIVHDADLQIGKLMWGDSGLYYCIITTPDDLEGKNEDSVELLVLGRTGLLADLLPSFAVEIMPE |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA with reconstitution instruction is sent along with the products. |
Gene Name | ILDR2 immunoglobulin-like domain containing receptor 2 [ Homo sapiens ] |
Official Symbol | ILDR2 |
Synonyms | C1orf32; dJ782G3.1; RP4-782G3.2; |
Gene ID | 387597 |
mRNA Refseq | NM_199351.2 |
Protein Refseq | NP_955383.1 |
UniProt ID | Q71H61 |
◆ Recombinant Proteins | ||
ILDR2-102H | Recombinant Human ILDR2(Leu21-Glu186) Protein, C-6*His-tagged | +Inquiry |
ILDR2-6744H | Recombinant Human ILDR2 protein, hFc-tagged | +Inquiry |
ILDR2-3297Z | Recombinant Zebrafish ILDR2 | +Inquiry |
ILDR2-105H | Recombinant Human ILDR2(Leu21-Glu186) Protein, C-Fc-tagged | +Inquiry |
ILDR2-1045H | Recombinant Human ILDR2 Protein (1-186 aa), GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ILDR2 Products
Required fields are marked with *
My Review for All ILDR2 Products
Required fields are marked with *
0
Inquiry Basket