Recombinant Human ILF3, His-tagged
Cat.No. : | ILF3-29491TH |
Product Overview : | Recombinant fragment, corresponding to amino acids 29-452 of Human ILF3 with N terminal His tag; 48.8 kDa ; |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 29-452 a.a. |
Description : | This gene encodes a double-stranded RNA (dsRNA) binding protein that complexes with other proteins, dsRNAs, small noncoding RNAs, and mRNAs to regulate gene expression and stabilize mRNAs. This protein was first discovered to be a subunit of the nuclear factor of activated T-cells (NFAT); a transcription factor required for T-cell expression of interleukin 2. NFAT is a heterodimer of 45 kDa and 90 kDa proteins, the larger of which is the product of this gene. These proteins have been shown to affect the redistribution of nuclear mRNA to the cytoplasm. Knockdown of NF45 or NF90 protein retards cell growth; possibly by inhibition of mRNA stabilization. In contrast, an isoform (NF110) of this gene that is predominantly restricted to the nucleus has only minor effects on cell growth when its levels are reduced. Alternative splicing results in multiple transcript variants encoding distinct isoforms. |
Conjugation : | HIS |
Tissue specificity : | Ubiquitous. |
Form : | Lyophilised:Reconstitute with 49μl distilled water. |
Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | EAVQNMVSHTERALKAVSDWIDEQEKGSSEQAESDNMDVP PEDDSKEGAGEQKTEHMTRTLRGVMRVGLVAKGLLLKG DLDLELVLLCKEKPTTALLDKVADNLAIQLAAVTEDKY EILQSVDDAAIVIKNTKEPPLSLTIHLTSPVVREEMEK VLAGETLSVNDPPDVLDRQKCLAALASLRHAKWFQARANG LKSCVIVIRVLRDLCTRVPTWGPLRGWPLELLCEKSIG TANRPMGAGEALRRVLECLASGIVMPDGSGIYDPCEKE ATDAIGHLDRQQREDITQSAQHALRLAAFGQLHKVLGM DPLPSKMPKKPKNENPVDYTVQIPPSTTYAITPMKRPM EEDGEEKSPSKKKKKIQKKEEKAEPPQAMNALMRLNQLKP GLQYKLVSQTGPVHAPIFTMSVEVDGNSFEASGPSKKT |
Sequence Similarities : | Contains 2 DRBM (double-stranded RNA-binding) domains.Contains 1 DZF domain. |
Gene Name | ILF3 interleukin enhancer binding factor 3, 90kDa [ Homo sapiens ] |
Official Symbol | ILF3 |
Synonyms | ILF3; interleukin enhancer binding factor 3, 90kDa; interleukin enhancer binding factor 3, 90kD; interleukin enhancer-binding factor 3; DRBP76; M phase phosphoprotein 4; MPHOSPH4; MPP4; NF90; NFAR 1; |
Gene ID | 3609 |
mRNA Refseq | NM_001137673 |
Protein Refseq | NP_001131145 |
MIM | 603182 |
Uniprot ID | Q12906 |
Chromosome Location | 19p13.2 |
Function | DNA binding; RNA binding; double-stranded RNA binding; protein binding; |
◆ Recombinant Proteins | ||
ILF3-8186M | Recombinant Mouse ILF3 Protein | +Inquiry |
ILF3-4524M | Recombinant Mouse ILF3 Protein, His (Fc)-Avi-tagged | +Inquiry |
ILF3-3051R | Recombinant Rat ILF3 Protein | +Inquiry |
ILF3-2710H | Recombinant Human ILF3 protein, His & T7-tagged | +Inquiry |
ILF3-1271H | Recombinant Human ILF3, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ILF3-5221HCL | Recombinant Human ILF3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ILF3 Products
Required fields are marked with *
My Review for All ILF3 Products
Required fields are marked with *
0
Inquiry Basket