Recombinant human immunoglobulin superfamily member 10 Protein, GST tagged
Cat.No. : | IGSF10-12H |
Product Overview : | Human IGSF10 partial ORF (NP_849144, 301-399 a.a.) recombinant protein with GST-tag at N-terminal was expressed in Wheat Germ (in vitro). |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Protein Length : | 301-399aa |
Description : | Predicted to be involved in regulation of neuron migration. Predicted to act upstream of or within ossification. Located in extracellular region. |
Tag : | N-GST |
Molecular Mass : | 36.63 kDa |
AA Sequence : | SAFISPQGFMAPFGSLTLNMTDQSGNEANMVCSIQKPSRTSPIAFTEENDYIVLNTSFSTFLVCNIDYGHIQPVWQILALYSDSPLILERSHLLSETPQ |
Quality Control Testing : | 12.5% SDS-PAGE Stained with Coomassie Blue. |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH8.0 in the elution buffer. |
Gene Name | IGSF10 immunoglobulin superfamily member 10 [ Homo sapiens (human) ] |
Official Symbol | IGSF10 |
Synonyms | IGSF10; immunoglobulin superfamily member 10; CMF608; immunoglobulin superfamily member 10; calvaria mechanical force protein 608 |
Gene ID | 285313 |
mRNA Refseq | NM_178822 |
Protein Refseq | NP_849144 |
MIM | 617351 |
UniProt ID | Q6WRI0 |
◆ Recombinant Proteins | ||
IGSF10-2669R | Recombinant Rat IGSF10 Protein, His (Fc)-Avi-tagged | +Inquiry |
IGSF10-8085M | Recombinant Mouse IGSF10 Protein | +Inquiry |
IGSF10-4478M | Recombinant Mouse IGSF10 Protein, His (Fc)-Avi-tagged | +Inquiry |
IGSF10-3014R | Recombinant Rat IGSF10 Protein | +Inquiry |
IGSF10-12H | Recombinant human immunoglobulin superfamily member 10 Protein, GST tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All IGSF10 Products
Required fields are marked with *
My Review for All IGSF10 Products
Required fields are marked with *