Recombinant human immunoglobulin superfamily member 10 Protein, GST tagged

Cat.No. : IGSF10-12H
Product Overview : Human IGSF10 partial ORF (NP_849144, 301-399 a.a.) recombinant protein with GST-tag at N-terminal was expressed in Wheat Germ (in vitro).
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Protein Length : 301-399aa
Description : Predicted to be involved in regulation of neuron migration. Predicted to act upstream of or within ossification. Located in extracellular region.
Tag : N-GST
Molecular Mass : 36.63 kDa
AA Sequence : SAFISPQGFMAPFGSLTLNMTDQSGNEANMVCSIQKPSRTSPIAFTEENDYIVLNTSFSTFLVCNIDYGHIQPVWQILALYSDSPLILERSHLLSETPQ
Quality Control Testing : 12.5% SDS-PAGE Stained with Coomassie Blue.
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH8.0 in the elution buffer.
Gene Name IGSF10 immunoglobulin superfamily member 10 [ Homo sapiens (human) ]
Official Symbol IGSF10
Synonyms IGSF10; immunoglobulin superfamily member 10; CMF608; immunoglobulin superfamily member 10; calvaria mechanical force protein 608
Gene ID 285313
mRNA Refseq NM_178822
Protein Refseq NP_849144
MIM 617351
UniProt ID Q6WRI0

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All IGSF10 Products

Required fields are marked with *

My Review for All IGSF10 Products

Required fields are marked with *

0
cart-icon