Recombinant Human IMPA1 protein(11-270 aa), C-His-tagged
| Cat.No. : | IMPA1-2712H |
| Product Overview : | Recombinant Human IMPA1 protein(P29218)(11-270 aa), fused with C-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 11-270 aa |
| Form : | 0.15 M Phosphate buffered saline |
| Storage : | Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing. Up to 12 months when aliquoted and stored at -20 to -80°C. |
| Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
| AA Sequence : | ADPWQECMDYAVTLARQAGEVVCEAIKNEMNVMLKSSPVDLVTATDQKVEKMLISSIKEKYPSHSFIGEESVAAGEKSILTDNPTWIIDPIDGTTNFVHRFPFVAVSIGFAVNKKIEFGVVYSCVEGKMYTARKGKGAFCNGQKLQVSQQEDITKSLLVTELGSSRTPETVRMVLSNMEKLFCIPVHGIRSVGTAAVNMCLVATGGADAYYEMGIHCWDVAGAGIIVTEAGGVLMDVTGGPFDLMSRRVIAANNRILAERIAKEIQVIPLQRDDED |
| Gene Name | IMPA1 inositol(myo)-1(or 4)-monophosphatase 1 [ Homo sapiens ] |
| Official Symbol | IMPA1 |
| Synonyms | IMPA1; inositol(myo)-1(or 4)-monophosphatase 1; IMPA; inositol monophosphatase 1; IMP 1; IMPase 1; inositol-1(or 4)-monophosphatase 1; lithium-sensitive myo-inositol monophosphatase A1; IMP; |
| Gene ID | 3612 |
| mRNA Refseq | NM_001144878 |
| Protein Refseq | NP_001138350 |
| MIM | 602064 |
| UniProt ID | P29218 |
| ◆ Recombinant Proteins | ||
| Impa1-3529M | Recombinant Mouse Impa1 Protein, Myc/DDK-tagged | +Inquiry |
| IMPA1-2712H | Recombinant Human IMPA1 protein(11-270 aa), C-His-tagged | +Inquiry |
| IMPA1-2712R | Recombinant Rat IMPA1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| IMPA1-2824H | Recombinant Human IMPA1, His-tagged | +Inquiry |
| IMPA1-770H | Recombinant Human IMPA1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| IMPA1-5214HCL | Recombinant Human IMPA1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All IMPA1 Products
Required fields are marked with *
My Review for All IMPA1 Products
Required fields are marked with *
