Recombinant Human IMPDH1 protein, His-tagged

Cat.No. : IMPDH1-280H
Product Overview : Recombinant Human IMPDH1 protein(NP_000874)(170-235 aa), fused to His tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 170-235 aa
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.). 5 % trehalose and 5 % mannitol are added as protectants before lyophilization.
AA Sequence : LSPSHTVGDVLEAKMRHGFSGIPITETGTMGSKLVGIVTSRDIDFLAEKDHTTLLSEVMTPRIELV
Purity : 95%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks).
Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
Reconstitution : Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.
Gene Name IMPDH1 IMP (inosine 5-monophosphate) dehydrogenase 1 [ Homo sapiens ]
Official Symbol IMPDH1
Synonyms IMPDH1; IMP (inosine 5-monophosphate) dehydrogenase 1; IMP (inosine monophosphate) dehydrogenase 1 , retinitis pigmentosa 10 (autosomal dominant) , RP10; inosine-5-monophosphate dehydrogenase 1; LCA11; sWSS2608; IMPD 1; IMPDH 1; IMPDH-I; IMP dehydrogenase 1; IMP (inosine monophosphate) dehydrogenase 1; IMPD; RP10; IMPD1; DKFZp781N0678;
Gene ID 3614
mRNA Refseq NM_000883
Protein Refseq NP_000874
MIM 146690
UniProt ID P20839

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All IMPDH1 Products

Required fields are marked with *

My Review for All IMPDH1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon