Recombinant Human IMPDH1 protein, His-tagged
Cat.No. : | IMPDH1-280H |
Product Overview : | Recombinant Human IMPDH1 protein(NP_000874)(170-235 aa), fused to His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 170-235 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.). 5 % trehalose and 5 % mannitol are added as protectants before lyophilization. |
AA Sequence : | LSPSHTVGDVLEAKMRHGFSGIPITETGTMGSKLVGIVTSRDIDFLAEKDHTTLLSEVMTPRIELV |
Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | IMPDH1 IMP (inosine 5-monophosphate) dehydrogenase 1 [ Homo sapiens ] |
Official Symbol | IMPDH1 |
Synonyms | IMPDH1; IMP (inosine 5-monophosphate) dehydrogenase 1; IMP (inosine monophosphate) dehydrogenase 1 , retinitis pigmentosa 10 (autosomal dominant) , RP10; inosine-5-monophosphate dehydrogenase 1; LCA11; sWSS2608; IMPD 1; IMPDH 1; IMPDH-I; IMP dehydrogenase 1; IMP (inosine monophosphate) dehydrogenase 1; IMPD; RP10; IMPD1; DKFZp781N0678; |
Gene ID | 3614 |
mRNA Refseq | NM_000883 |
Protein Refseq | NP_000874 |
MIM | 146690 |
UniProt ID | P20839 |
◆ Recombinant Proteins | ||
IMPDH1-2580H | Recombinant Human IMPDH1, His-tagged | +Inquiry |
IMPDH1-4534M | Recombinant Mouse IMPDH1 Protein, His (Fc)-Avi-tagged | +Inquiry |
Impdh1-3531M | Recombinant Mouse Impdh1 Protein, Myc/DDK-tagged | +Inquiry |
IMPDH1-28268TH | Recombinant Human IMPDH1, His-tagged | +Inquiry |
IMPDH1-5140H | Recombinant Human IMPDH1 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
IMPDH1-5212HCL | Recombinant Human IMPDH1 293 Cell Lysate | +Inquiry |
IMPDH1-5211HCL | Recombinant Human IMPDH1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All IMPDH1 Products
Required fields are marked with *
My Review for All IMPDH1 Products
Required fields are marked with *
0
Inquiry Basket