Recombinant Human IMPG2 Protein, GST-tagged

Cat.No. : IMPG2-5137H
Product Overview : Human IMPG2 partial ORF ( NP_057331.2, 572 a.a. - 678 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : Interphotoreceptor matrix proteoglycan-2 is part of an extracellular complex occupying the interface between photoreceptors and the retinal pigment epithelium in the fundus of the eye.[supplied by OMIM
Molecular Mass : 37.51 kDa
AA Sequence : LTSKVKDQLKVSPFLPDASMEKELIFDGGLGSGSGQKVDLITWPWSETSSEKSAEPLSKPWLEDDDSLLPAEIEDKKLVLVDKMDSTDQISKHSKYEHDDRSTHFPE
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name IMPG2 interphotoreceptor matrix proteoglycan 2 [ Homo sapiens (human) ]
Official Symbol IMPG2
Synonyms IMPG2; interphotoreceptor matrix proteoglycan 2; RP56; VMD5; IPM200; SPACRCAN; interphotoreceptor matrix proteoglycan 2; IPM 200; interphotoreceptor matrix proteoglycan IPM 200; interphotoreceptor matrix proteoglycan of 200 kDa; sialoprotein associated with cones and rods proteoglycan;
Gene ID 50939
mRNA Refseq NM_016247
Protein Refseq NP_057331
MIM 607056
UniProt ID Q9BZV3

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All IMPG2 Products

Required fields are marked with *

My Review for All IMPG2 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon