Recombinant Human IMPG2 Protein, GST-tagged
Cat.No. : | IMPG2-5137H |
Product Overview : | Human IMPG2 partial ORF ( NP_057331.2, 572 a.a. - 678 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | Interphotoreceptor matrix proteoglycan-2 is part of an extracellular complex occupying the interface between photoreceptors and the retinal pigment epithelium in the fundus of the eye.[supplied by OMIM |
Molecular Mass : | 37.51 kDa |
AA Sequence : | LTSKVKDQLKVSPFLPDASMEKELIFDGGLGSGSGQKVDLITWPWSETSSEKSAEPLSKPWLEDDDSLLPAEIEDKKLVLVDKMDSTDQISKHSKYEHDDRSTHFPE |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | IMPG2 interphotoreceptor matrix proteoglycan 2 [ Homo sapiens (human) ] |
Official Symbol | IMPG2 |
Synonyms | IMPG2; interphotoreceptor matrix proteoglycan 2; RP56; VMD5; IPM200; SPACRCAN; interphotoreceptor matrix proteoglycan 2; IPM 200; interphotoreceptor matrix proteoglycan IPM 200; interphotoreceptor matrix proteoglycan of 200 kDa; sialoprotein associated with cones and rods proteoglycan; |
Gene ID | 50939 |
mRNA Refseq | NM_016247 |
Protein Refseq | NP_057331 |
MIM | 607056 |
UniProt ID | Q9BZV3 |
◆ Recombinant Proteins | ||
IMPG2-3431C | Recombinant Chicken IMPG2 | +Inquiry |
IMPG2-2717R | Recombinant Rat IMPG2 Protein, His (Fc)-Avi-tagged | +Inquiry |
IMPG2-825H | Recombinant Human IMPG2 | +Inquiry |
IMPG2-5137H | Recombinant Human IMPG2 Protein, GST-tagged | +Inquiry |
IMPG2-4537M | Recombinant Mouse IMPG2 Protein, His (Fc)-Avi-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All IMPG2 Products
Required fields are marked with *
My Review for All IMPG2 Products
Required fields are marked with *
0
Inquiry Basket