Recombinant Human INA, GST-tagged
Cat.No. : | INA-829H |
Product Overview : | Recombinant Human INA (1 a.a. - 499 a.a.), fused with GST-tag at N-terminal, was expressed in wheat germ. |
Availability | July 01, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Citation
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | Neurofilaments are type IV intermediate filament heteropolymers composed of light, medium, and heavy chains. Neurofilaments comprise the axoskeleton and they functionally maintain the neuronal caliber. They may also play a role in intracellular transport to axons and dendrites. This gene is a member of the intermediate filament family and is involved in the morphogenesis of neurons. |
Molecular Mass : | 81.8 kDa |
AA Sequence : | MSFGSEHYLCSSSSYRKVFGDGSRLSARLSGAGGAGGFRSQSLSRSNVASSAACSSASSLGLGLAYRRPPASDGL DLSQAAARTNEYKIIRTNEKEQLQGLNDRFAVFIEKVHQLETQNRALEAELAALRQRHAEPSRVGELFQRELRDL RAQLEEASSARSQALLERDGLAEEVQRLRARCEEESRGREGAERALKAQQRDVDGATLARLDLEKKVESLLDELA FVRQVHDEEVAELLATLQASSQAAAEVDVTVAKPDLTSALREIRAQYESLAAKNLQSAEEWYKSKFANLNEQAAR STEAIRASREEIHEYRRQLQARTIEIEGLRGANESLERQILELEERHSAEVAGYQDSIGQLENDLRNTKSEMARH LREYQDLLNVKMALDIEIAAYRKLLEGEETRFSTSGLSISGLNPLPNPSYLLPPRILSATTSKVSSTGLSLKKEE EEEEASKVASKKTSQIGESFEEILEETVISTKKTEKSNIEETTISSQKI |
Applications : | ELISA; WB-Re; AP; Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80°C. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Publications : |
Epigenetic Inactivation of α-Internexin Accelerates Microtubule Polymerization in Colorectal Cancer (2020)
|
Gene Name | INA internexin neuronal intermediate filament protein, alpha [ Homo sapiens (human) ] |
Official Symbol | INA |
Synonyms | INA; NEF5; NF-66; TXBP-1; internexin neuronal intermediate filament protein, alpha; alpha-internexin; alpha-Inx; neurofilament 5 (66kD); 66 kDa neurofilament protein; neurofilament-66, tax-binding protein |
Gene ID | 9118 |
mRNA Refseq | NM_032727 |
Protein Refseq | NP_116116 |
MIM | 605338 |
UniProt ID | Q16352 |
Chromosome Location | 10q24.33 |
Function | structural constituent of cytoskeleton |
◆ Recombinant Proteins | ||
INA-2267R | Recombinant Rhesus monkey INA Protein, His-tagged | +Inquiry |
INA-66H | Recombinant Human INA Protein, His-tagged | +Inquiry |
INA-829H | Recombinant Human INA, GST-tagged | +Inquiry |
Ina-3368R | Recombinant Rat Ina, His-tagged | +Inquiry |
INA-64H | Recombinant Human INA | +Inquiry |
Epigenetic Inactivation of α-Internexin Accelerates Microtubule Polymerization in Colorectal Cancer
Journal: Cancer Research Data: 2020/10/13
Authors: Yingjie Li, Liangliang Bai, Yanxin Luo
Article Snippet:To determine the activity of INA and tubulin-binding peptides on microtubule polymerization, 3 mg/ml pure tubulin proteins were diluted in the tubulin polymerization buffer and pipetted into the half area 96- well plates.To determine the activity of INA and tubulin-binding peptides on microtubule polymerization, 3 mg/ml pure tubulin proteins were diluted in the tubulin polymerization buffer and pipetted into the half area 96- well plates.. Recombinant GST-tagged INA (Creative BioMart, Shirley, NY) , GST (Sino Biological), custom-created peptides (Sangon), and nocodazole (Selleck, Houston, TX) were added to the mixtures.. Signals were recorded within 60 minutes after reaction initiation according to OD-based measurements taken every minute with a Varioskan Flash reader (Thermo, Waltham, MA) at 37 °C.Signals were recorded within 60 minutes after reaction initiation according to OD-based measurements taken every minute with a Varioskan Flash reader (Thermo, Waltham, MA) at 37 °C.
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All INA Products
Required fields are marked with *
My Review for All INA Products
Required fields are marked with *