Recombinant Human INA, GST-tagged
| Cat.No. : | INA-829H |
| Product Overview : | Recombinant Human INA (1 a.a. - 499 a.a.), fused with GST-tag at N-terminal, was expressed in wheat germ. |
| Availability | June 04, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Citation
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | Neurofilaments are type IV intermediate filament heteropolymers composed of light, medium, and heavy chains. Neurofilaments comprise the axoskeleton and they functionally maintain the neuronal caliber. They may also play a role in intracellular transport to axons and dendrites. This gene is a member of the intermediate filament family and is involved in the morphogenesis of neurons. |
| Molecular Mass : | 81.8 kDa |
| AA Sequence : | MSFGSEHYLCSSSSYRKVFGDGSRLSARLSGAGGAGGFRSQSLSRSNVASSAACSSASSLGLGLAYRRPPASDGL DLSQAAARTNEYKIIRTNEKEQLQGLNDRFAVFIEKVHQLETQNRALEAELAALRQRHAEPSRVGELFQRELRDL RAQLEEASSARSQALLERDGLAEEVQRLRARCEEESRGREGAERALKAQQRDVDGATLARLDLEKKVESLLDELA FVRQVHDEEVAELLATLQASSQAAAEVDVTVAKPDLTSALREIRAQYESLAAKNLQSAEEWYKSKFANLNEQAAR STEAIRASREEIHEYRRQLQARTIEIEGLRGANESLERQILELEERHSAEVAGYQDSIGQLENDLRNTKSEMARH LREYQDLLNVKMALDIEIAAYRKLLEGEETRFSTSGLSISGLNPLPNPSYLLPPRILSATTSKVSSTGLSLKKEE EEEEASKVASKKTSQIGESFEEILEETVISTKKTEKSNIEETTISSQKI |
| Applications : | ELISA; WB-Re; AP; Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80°C. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Publications : |
| Gene Name | INA internexin neuronal intermediate filament protein, alpha [ Homo sapiens (human) ] |
| Official Symbol | INA |
| Synonyms | INA; NEF5; NF-66; TXBP-1; internexin neuronal intermediate filament protein, alpha; alpha-internexin; alpha-Inx; neurofilament 5 (66kD); 66 kDa neurofilament protein; neurofilament-66, tax-binding protein |
| Gene ID | 9118 |
| mRNA Refseq | NM_032727 |
| Protein Refseq | NP_116116 |
| MIM | 605338 |
| UniProt ID | Q16352 |
| Chromosome Location | 10q24.33 |
| Function | structural constituent of cytoskeleton |
| ◆ Recombinant Proteins | ||
| INA-3062R | Recombinant Rat INA Protein | +Inquiry |
| INA-6955HF | Recombinant Full Length Human INA Protein, GST-tagged | +Inquiry |
| INA-64H | Recombinant Human INA | +Inquiry |
| INA-4538M | Recombinant Mouse INA Protein, His (Fc)-Avi-tagged | +Inquiry |
| INA-829H | Recombinant Human INA, GST-tagged | +Inquiry |
Epigenetic Inactivation of α-Internexin Accelerates Microtubule Polymerization in Colorectal Cancer
Journal: Cancer Research Data: 2020/10/13
Authors: Yingjie Li, Liangliang Bai, Yanxin Luo
Article Snippet:To determine the activity of INA and tubulin-binding peptides on microtubule polymerization, 3 mg/ml pure tubulin proteins were diluted in the tubulin polymerization buffer and pipetted into the half area 96- well plates.To determine the activity of INA and tubulin-binding peptides on microtubule polymerization, 3 mg/ml pure tubulin proteins were diluted in the tubulin polymerization buffer and pipetted into the half area 96- well plates.. Recombinant GST-tagged INA (Creative BioMart, Shirley, NY) , GST (Sino Biological), custom-created peptides (Sangon), and nocodazole (Selleck, Houston, TX) were added to the mixtures.. Signals were recorded within 60 minutes after reaction initiation according to OD-based measurements taken every minute with a Varioskan Flash reader (Thermo, Waltham, MA) at 37 °C.Signals were recorded within 60 minutes after reaction initiation according to OD-based measurements taken every minute with a Varioskan Flash reader (Thermo, Waltham, MA) at 37 °C.
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All INA Products
Required fields are marked with *
My Review for All INA Products
Required fields are marked with *
