Recombinant Human INADL Protein, GST-tagged

Cat.No. : INADL-5136H
Product Overview : Human INADL partial ORF ( NP_733750, 545 a.a. - 651 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene encodes a protein with multiple PDZ domains. PDZ domains mediate protein-protein interactions, and proteins with multiple PDZ domains often organize multimeric complexes at the plasma membrane. This protein localizes to tight junctions and to the apical membrane of epithelial cells. A similar protein in Drosophila is a scaffolding protein which tethers several members of a multimeric signaling complex in photoreceptors. [provided by RefSeq
Molecular Mass : 37.51 kDa
AA Sequence : TLDTQIADDAELQKYSKLLPIHTLRLGVEVDSFDGHHYISSIVSGGPVDTLGLLQPEDELLEVNGMQLYGKSRREAVSFLKEVPPPFTLVCCRRLFDDEASVDEPRR
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name INADL InaD-like (Drosophila) [ Homo sapiens ]
Official Symbol INADL
Synonyms INADL; InaD-like (Drosophila); inaD-like protein; Cipp; PATJ; PDZ domain protein; protein associated to tight junctions; channel-interacting PDZ domain protein; PALS1-associated tight junction protein; inactivation no after-potential D-like protein; hINADL; InaD-like; FLJ26982;
Gene ID 10207
mRNA Refseq NM_176877
Protein Refseq NP_795352
MIM 603199
UniProt ID Q8NI35

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All INADL Products

Required fields are marked with *

My Review for All INADL Products

Required fields are marked with *

0

Inquiry Basket

cartIcon