Recombinant Human INADL Protein, GST-tagged

• Cat.No.: INADL-5136H
• Product Overview: Human INADL partial ORF ( NP_733750, 545 a.a. - 651 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: This gene encodes a protein with multiple PDZ domains. PDZ domains mediate protein-protein interactions, and proteins with multiple PDZ domains often organize multimeric complexes at the plasma membrane. This protein localizes to tight junctions and to the apical membrane of epithelial cells. A similar protein in Drosophila is a scaffolding protein which tethers several members of a multimeric signaling complex in photoreceptors. [provided by RefSeq
• Molecular Mass: 37.51 kDa
• AA Sequence: TLDTQIADDAELQKYSKLLPIHTLRLGVEVDSFDGHHYISSIVSGGPVDTLGLLQPEDELLEVNGMQLYGKSRREAVSFLKEVPPPFTLVCCRRLFDDEASVDEPRR
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: INADL InaD-like (Drosophila) [ Homo sapiens ]
• Official Symbol: INADL
• Synonyms: INADL; InaD-like (Drosophila); inaD-like protein; Cipp; PATJ; PDZ domain protein; protein associated to tight junctions; channel-interacting PDZ domain protein; PALS1-associated tight junction protein; inactivation no after-potential D-like protein; hINADL; InaD-like; FLJ26982
• Gene ID: 10207
• mRNA Refseq: NM_176877
• Protein Refseq: NP_795352
• MIM: 603199
• UniProt ID: Q8NI35