Recombinant Human ING1
Cat.No. : | ING1-28775TH |
Product Overview : | Recombinant full length Human ING1, isoform 2 with a N terminal proprietary tag: Predicted MW 56.76 kDa. |
- Specification
- Gene Information
- Related Products
Description : | This gene encodes a tumor suppressor protein that can induce cell growth arrest and apoptosis. The encoded protein is a nuclear protein that physically interacts with the tumor suppressor protein TP53 and is a component of the p53 signaling pathway. Reduced expression and rearrangement of this gene have been detected in various cancers. Multiple alternatively spliced transcript variants encoding distinct isoforms have been reported. |
Protein length : | 279 amino acids |
Molecular Weight : | 56.760kDa inclusive of tags |
Source : | Wheat germ |
Tissue specificity : | Isoform 2 was expressed in all normal tissues and cells examined, as well as in all breast cancer and melanoma cell lines examined. Isoform 3 was expressed in testis, liver, and kidney, weakly expressed in colon and brain and not expressed in breast and c |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | MLSPANGEQLHLVNYVEDYLDSIESLPFDLQRNVSLMREI DAKYQEILKELDECYERFSRETDGAQKRRMLHCVQRALIR SQELGDEKIQIVSQMVELVENRTRQVDSHVELFEAQQELG DTAGNSGKAGADRPKGEAAAQADKPNSKRSRRQRNNENRE NASSNHDHDDGASGTPKEKKAKTSKKKKRSKAKAEREASP ADLPIDPNEPTYCLCNQVSYGEMIGCDNDECPIEWFHFSC VGLNHKPKGKWYCPKCRGENEKTMDKALEKSKKERAYNR |
Sequence Similarities : | Belongs to the ING family.Contains 1 PHD-type zinc finger. |
Gene Name : | ING1 inhibitor of growth family, member 1 [ Homo sapiens ] |
Official Symbol : | ING1 |
Synonyms : | ING1; inhibitor of growth family, member 1; inhibitor of growth protein 1; growth inhibitor ING1; growth inhibitory protein ING1; inhibitor of growth 1; p24ING1c; p33; p33ING1; p33ING1b; p47; p47ING1a; tumor suppressor ING1; |
Gene ID : | 3621 |
mRNA Refseq : | NM_198217 |
Protein Refseq : | NP_937860 |
MIM : | 601566 |
Uniprot ID : | Q9UK53 |
Chromosome Location : | 13q34 |
Pathway : | Senescence and Autophagy, organism-specific biosystem; |
Function : | metal ion binding; methylated histone residue binding; zinc ion binding; |
Products Types
◆ Recombinant Protein | ||
ING1-2405H | Recombinant Human ING1 Protein, MYC/DDK-tagged | +Inquiry |
ING1-4542M | Recombinant Mouse ING1 Protein, His (Fc)-Avi-tagged | +Inquiry |
Ing1-3535M | Recombinant Mouse Ing1 Protein, Myc/DDK-tagged | +Inquiry |
ING1-5132H | Recombinant Human ING1 Protein, GST-tagged | +Inquiry |
ING1-2089R | Recombinant Rhesus Macaque ING1 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Lysates | ||
ING1-860HCL | Recombinant Human ING1 cell lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
0
Inquiry Basket