Recombinant Human ING1
| Cat.No. : | ING1-28775TH |
| Product Overview : | Recombinant full length Human ING1, isoform 2 with a N terminal proprietary tag: Predicted MW 56.76 kDa. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | Non |
| Protein Length : | 279 amino acids |
| Description : | This gene encodes a tumor suppressor protein that can induce cell growth arrest and apoptosis. The encoded protein is a nuclear protein that physically interacts with the tumor suppressor protein TP53 and is a component of the p53 signaling pathway. Reduced expression and rearrangement of this gene have been detected in various cancers. Multiple alternatively spliced transcript variants encoding distinct isoforms have been reported. |
| Molecular Weight : | 56.760kDa inclusive of tags |
| Tissue specificity : | Isoform 2 was expressed in all normal tissues and cells examined, as well as in all breast cancer and melanoma cell lines examined. Isoform 3 was expressed in testis, liver, and kidney, weakly expressed in colon and brain and not expressed in breast and c |
| Form : | Liquid |
| Purity : | Proprietary Purification |
| Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
| Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
| Sequences of amino acids : | MLSPANGEQLHLVNYVEDYLDSIESLPFDLQRNVSLMREI DAKYQEILKELDECYERFSRETDGAQKRRMLHCVQRALIR SQELGDEKIQIVSQMVELVENRTRQVDSHVELFEAQQELG DTAGNSGKAGADRPKGEAAAQADKPNSKRSRRQRNNENRE NASSNHDHDDGASGTPKEKKAKTSKKKKRSKAKAEREASP ADLPIDPNEPTYCLCNQVSYGEMIGCDNDECPIEWFHFSC VGLNHKPKGKWYCPKCRGENEKTMDKALEKSKKERAYNR |
| Sequence Similarities : | Belongs to the ING family.Contains 1 PHD-type zinc finger. |
| Gene Name | ING1 inhibitor of growth family, member 1 [ Homo sapiens ] |
| Official Symbol | ING1 |
| Synonyms | ING1; inhibitor of growth family, member 1; inhibitor of growth protein 1; growth inhibitor ING1; growth inhibitory protein ING1; inhibitor of growth 1; p24ING1c; p33; p33ING1; p33ING1b; p47; p47ING1a; tumor suppressor ING1; |
| Gene ID | 3621 |
| mRNA Refseq | NM_198217 |
| Protein Refseq | NP_937860 |
| MIM | 601566 |
| Uniprot ID | Q9UK53 |
| Chromosome Location | 13q34 |
| Pathway | Senescence and Autophagy, organism-specific biosystem; |
| Function | metal ion binding; methylated histone residue binding; zinc ion binding; |
| ◆ Recombinant Proteins | ||
| ING1-256HF | Recombinant Full Length Human ING1 Protein | +Inquiry |
| ING1-4542M | Recombinant Mouse ING1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ING1-2268R | Recombinant Rhesus monkey ING1 Protein, His-tagged | +Inquiry |
| ING1-6483H | Recombinant Human ING1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| ING1-2089R | Recombinant Rhesus Macaque ING1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| ING1-860HCL | Recombinant Human ING1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ING1 Products
Required fields are marked with *
My Review for All ING1 Products
Required fields are marked with *



