Recombinant Human ING1

Cat.No. : ING1-28775TH
Product Overview : Recombinant full length Human ING1, isoform 2 with a N terminal proprietary tag: Predicted MW 56.76 kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 279 amino acids
Description : This gene encodes a tumor suppressor protein that can induce cell growth arrest and apoptosis. The encoded protein is a nuclear protein that physically interacts with the tumor suppressor protein TP53 and is a component of the p53 signaling pathway. Reduced expression and rearrangement of this gene have been detected in various cancers. Multiple alternatively spliced transcript variants encoding distinct isoforms have been reported.
Molecular Weight : 56.760kDa inclusive of tags
Tissue specificity : Isoform 2 was expressed in all normal tissues and cells examined, as well as in all breast cancer and melanoma cell lines examined. Isoform 3 was expressed in testis, liver, and kidney, weakly expressed in colon and brain and not expressed in breast and c
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : MLSPANGEQLHLVNYVEDYLDSIESLPFDLQRNVSLMREI DAKYQEILKELDECYERFSRETDGAQKRRMLHCVQRALIR SQELGDEKIQIVSQMVELVENRTRQVDSHVELFEAQQELG DTAGNSGKAGADRPKGEAAAQADKPNSKRSRRQRNNENRE NASSNHDHDDGASGTPKEKKAKTSKKKKRSKAKAEREASP ADLPIDPNEPTYCLCNQVSYGEMIGCDNDECPIEWFHFSC VGLNHKPKGKWYCPKCRGENEKTMDKALEKSKKERAYNR
Sequence Similarities : Belongs to the ING family.Contains 1 PHD-type zinc finger.
Gene Name ING1 inhibitor of growth family, member 1 [ Homo sapiens ]
Official Symbol ING1
Synonyms ING1; inhibitor of growth family, member 1; inhibitor of growth protein 1; growth inhibitor ING1; growth inhibitory protein ING1; inhibitor of growth 1; p24ING1c; p33; p33ING1; p33ING1b; p47; p47ING1a; tumor suppressor ING1;
Gene ID 3621
mRNA Refseq NM_198217
Protein Refseq NP_937860
MIM 601566
Uniprot ID Q9UK53
Chromosome Location 13q34
Pathway Senescence and Autophagy, organism-specific biosystem;
Function metal ion binding; methylated histone residue binding; zinc ion binding;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ING1 Products

Required fields are marked with *

My Review for All ING1 Products

Required fields are marked with *

0
cart-icon