Recombinant Human ING1 Protein, His tagged
| Cat.No. : | ING1-001H |
| Product Overview : | Recombinant Human ING1 Protein (213-327 aa) with His tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 213-327 aa |
| Description : | This gene encodes a tumor suppressor protein that can induce cell growth arrest and apoptosis. The encoded protein is a nuclear protein that physically interacts with the tumor suppressor protein TP53 and is a component of the p53 signaling pathway. Reduced expression and rearrangement of this gene have been detected in various cancers. Multiple alternatively spliced transcript variants encoding distinct isoforms have been reported. |
| Molecular Mass : | 14 kDa |
| Purity : | > 90% by SDS-PAGE |
| AA Sequence : | MLHCVQRALIRSQELGDEKIQIVSQMVELVENRTRQVDSHVELFEAQQELGDTAGNSGKAGADRPKGEAAAQADKPNSKRSRRQRNNENRENASSNHDHDDGASGTPKEKKAKTSHHHHHHHH |
| Endotoxin : | < 1.0 EU/μg by LAL |
| Storage : | Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
| Storage Buffer : | Sterile PBS, pH8.2, 8% Trehalose, 10% Glycerol |
| Concentration : | 1 mg/mL by BCA |
| Gene Name | ING1 inhibitor of growth family member 1 [ Homo sapiens (human) ] |
| Official Symbol | ING1 |
| Synonyms | ING1; inhibitor of growth family, member 1; inhibitor of growth protein 1; growth inhibitor ING1; growth inhibitory protein ING1; inhibitor of growth 1; p24ING1c; p33; p33ING1; p33ING1b; p47; p47ING1a; tumor suppressor ING1 |
| Gene ID | 3621 |
| mRNA Refseq | NM_005537 |
| Protein Refseq | NP_005528 |
| MIM | 601566 |
| UniProt ID | Q9UK53 |
| ◆ Recombinant Proteins | ||
| ING1-1480H | Recombinant Human Inhibitor Of Growth Family, Member 1, His-tagged | +Inquiry |
| ING1-4542M | Recombinant Mouse ING1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ING1-2268R | Recombinant Rhesus monkey ING1 Protein, His-tagged | +Inquiry |
| ING1-256HF | Recombinant Full Length Human ING1 Protein | +Inquiry |
| ING1-3780Z | Recombinant Zebrafish ING1 | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| ING1-860HCL | Recombinant Human ING1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ING1 Products
Required fields are marked with *
My Review for All ING1 Products
Required fields are marked with *
