Recombinant Human ING5, His-tagged
Cat.No. : | ING5-27620TH |
Product Overview : | Recombinant fragment, corresponding to amino acids 2-240 of Human ING5 with N terminal His tag; 239 amino acids, kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 2-240 a.a. |
Description : | The protein encoded by this gene is similar to ING1, a tumor suppressor protein that can interact with TP53, inhibit cell growth, and induce apoptosis. This protein contains a PHD-finger, which is a common motif in proteins involved in chromatin remodeling. This protein can bind TP53 and EP300/p300, a component of the histone acetyl transferase complex, suggesting its involvement in TP53-dependent regulatory pathway. |
Conjugation : | HIS |
Form : | Lyophilised:Reconstitute with 71 μl aqua dest. |
Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | ATAMYLEHYLDSIENLPCELQRNFQLMRELDQRTEDKKAE IDILAAEYISTVKTLSPDQRVERLQKIQNAYSKCKEYS DDKVQLAMQTYEMVDKHIRRLDADLARFEADLKDKMEGSDFESSGGRGLKKGRGQKEKRGSRGRGRRTSEEDTPKKKK HKGGSEFTDTILSVHPSDVLDMPVDPNEPTYCLCHQVS YGEMIGCDNPDCPIEWFHFACVDLTTKPKGKWFCPRCVQEKRKKK |
Gene Name | ING5 inhibitor of growth family, member 5 [ Homo sapiens ] |
Official Symbol | ING5 |
Synonyms | ING5; inhibitor of growth family, member 5; inhibitor of growth protein 5; FLJ23842; p28ING5; |
Gene ID | 84289 |
mRNA Refseq | NM_032329 |
Protein Refseq | NP_115705 |
MIM | 608525 |
Uniprot ID | Q8WYH8 |
Chromosome Location | 2q37.3 |
Function | metal ion binding; methylated histone residue binding; protein binding; zinc ion binding; |
◆ Recombinant Proteins | ||
ING5-8211M | Recombinant Mouse ING5 Protein | +Inquiry |
ING5-5124H | Recombinant Human ING5 Protein, GST-tagged | +Inquiry |
ING5-2966C | Recombinant Chicken ING5 | +Inquiry |
ING5-2091R | Recombinant Rhesus Macaque ING5 Protein, His (Fc)-Avi-tagged | +Inquiry |
ING5-27620TH | Recombinant Human ING5, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ING5-5205HCL | Recombinant Human ING5 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ING5 Products
Required fields are marked with *
My Review for All ING5 Products
Required fields are marked with *
0
Inquiry Basket