Recombinant Human INHBA Protein (AA 21-426), N-GFP/His-Tagged
Cat.No. : | INHBA-32H |
Product Overview : | Recombinant Human INHBA Protein (AA 21-426) with N-GFP/His tag was expressed in HEK293. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | GFP&His |
Protein Length : | AA 21-426 |
Description : | This gene encodes a member of the TGF-beta (transforming growth factor-beta) superfamily of proteins. The encoded preproprotein is proteolytically processed to generate a subunit of the dimeric activin and inhibin protein complexes. These complexes activate and inhibit, respectively, follicle stimulating hormone secretion from the pituitary gland. The encoded protein also plays a role in eye, tooth and testis development. Elevated expression of this gene may be associated with cancer cachexia in human patients. |
Form : | Liquid |
AA Sequence : | MSPTPGSEGHSAAPDCPSCALAALPKDVPNSQPEMVEAVKKHILNMLHLKKRPDVTQPVPKAALLNAIRKLHVGKVGENGYVEIEDDIGRRAEMNELMEQTSEIITFAESGTARKTLHFEISKEGSDLSVVERAEVWLFLKVPKANRTRTKVTIRLFQQQKHPQGSLDTGEEAEEVGLKGERSELLLSEKVVDARKSTWHVFPVSSSIQRLLDQGKSSLDVRIACEQCQESGASLVLLGKKKKKEEEGEGKKKGGGEGGAGADEEKEQSHRPFLMLQARQSEDHPHRRRRRGLXXXGLECDGKVNICCKKQFFVSFKDIGWNDWIIAPSGYHANYCEGECPSHIAGTSGSSLSFHSTVINHYRMRGHSPFANLKSCCVPTKLRPMSMLYYDDGQNIIKKDIQNMIVEECGCSXXX indicates position of His-tag. |
Purity : | > 95% as determined by SDS-PAGE |
Storage : | Stored and shipped at -80 centigrade |
Storage Buffer : | PBS, pH 7.4 |
Gene Name | INHBA inhibin, beta A [ Homo sapiens ] |
Official Symbol | INHBA |
Synonyms | INHBA; inhibin, beta A; inhibin, beta A (activin A, activin AB alpha polypeptide); inhibin beta A chain; Inhibin, beta-1; activin beta-A chain; FSH-releasing protein; erythroid differentiation factor; erythroid differentiation protein; follicle-stimulating hormone-releasing protein; EDF; FRP |
Gene ID | 3624 |
mRNA Refseq | NM_002192 |
Protein Refseq | NP_002183 |
MIM | 147290 |
UniProt ID | P08476 |
◆ Recombinant Proteins | ||
INHBA-23H | Recombinant Human/Mouse/Rat INHBA Protein | +Inquiry |
INHBA-7803C | Recombinant Chicken INHBA protein, His-tagged | +Inquiry |
INHBA-2404H | Recombinant Human INHBA Protein, MYC/DDK-tagged | +Inquiry |
INHBA-5120H | Recombinant Human INHBA Protein, GST-tagged | +Inquiry |
INHBA-5889HF | Recombinant Full Length Human INHBA Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
INHBA-2078MCL | Recombinant Mouse INHBA cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All INHBA Products
Required fields are marked with *
My Review for All INHBA Products
Required fields are marked with *
0
Inquiry Basket