Recombinant Human INHBA Protein (AA 21-426), N-GFP/His-Tagged
| Cat.No. : | INHBA-32H |
| Product Overview : | Recombinant Human INHBA Protein (AA 21-426) with N-GFP/His tag was expressed in HEK293. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | GFP&His |
| Protein Length : | AA 21-426 |
| Description : | This gene encodes a member of the TGF-beta (transforming growth factor-beta) superfamily of proteins. The encoded preproprotein is proteolytically processed to generate a subunit of the dimeric activin and inhibin protein complexes. These complexes activate and inhibit, respectively, follicle stimulating hormone secretion from the pituitary gland. The encoded protein also plays a role in eye, tooth and testis development. Elevated expression of this gene may be associated with cancer cachexia in human patients. |
| Form : | Liquid |
| AA Sequence : | MSPTPGSEGHSAAPDCPSCALAALPKDVPNSQPEMVEAVKKHILNMLHLKKRPDVTQPVPKAALLNAIRKLHVGKVGENGYVEIEDDIGRRAEMNELMEQTSEIITFAESGTARKTLHFEISKEGSDLSVVERAEVWLFLKVPKANRTRTKVTIRLFQQQKHPQGSLDTGEEAEEVGLKGERSELLLSEKVVDARKSTWHVFPVSSSIQRLLDQGKSSLDVRIACEQCQESGASLVLLGKKKKKEEEGEGKKKGGGEGGAGADEEKEQSHRPFLMLQARQSEDHPHRRRRRGLXXXGLECDGKVNICCKKQFFVSFKDIGWNDWIIAPSGYHANYCEGECPSHIAGTSGSSLSFHSTVINHYRMRGHSPFANLKSCCVPTKLRPMSMLYYDDGQNIIKKDIQNMIVEECGCSXXX indicates position of His-tag. |
| Purity : | > 95% as determined by SDS-PAGE |
| Storage : | Stored and shipped at -80 centigrade |
| Storage Buffer : | PBS, pH 7.4 |
| Gene Name | INHBA inhibin, beta A [ Homo sapiens ] |
| Official Symbol | INHBA |
| Synonyms | INHBA; inhibin, beta A; inhibin, beta A (activin A, activin AB alpha polypeptide); inhibin beta A chain; Inhibin, beta-1; activin beta-A chain; FSH-releasing protein; erythroid differentiation factor; erythroid differentiation protein; follicle-stimulating hormone-releasing protein; EDF; FRP |
| Gene ID | 3624 |
| mRNA Refseq | NM_002192 |
| Protein Refseq | NP_002183 |
| MIM | 147290 |
| UniProt ID | P08476 |
| ◆ Recombinant Proteins | ||
| INHBA-267H | Active Recombinant Human INHBA protein | +Inquiry |
| INHBA-955H | Active Recombinant Human INHBA Protein | +Inquiry |
| INHBA-3114H | Recombinant Human INHBA Protein (Met1-Ser426), C-Strep tagged | +Inquiry |
| INHBA-1542H | Recombinant human Activin A, Active, His-tagged | +Inquiry |
| INHBA-5623H | Recombinant Human INHBA Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| INHBA-2078MCL | Recombinant Mouse INHBA cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All INHBA Products
Required fields are marked with *
My Review for All INHBA Products
Required fields are marked with *
