Recombinant Human INHBA Protein (AA 21-426), N-GFP/His-Tagged

• Cat.No.: INHBA-32H
• Product Overview: Recombinant Human INHBA Protein (AA 21-426) with N-GFP/His tag was expressed in HEK293.

Specification

• Species: Human
• Source: HEK293
• Tag: GFP&His
• Protein Length: AA 21-426
• Description: This gene encodes a member of the TGF-beta (transforming growth factor-beta) superfamily of proteins. The encoded preproprotein is proteolytically processed to generate a subunit of the dimeric activin and inhibin protein complexes. These complexes activate and inhibit, respectively, follicle stimulating hormone secretion from the pituitary gland. The encoded protein also plays a role in eye, tooth and testis development. Elevated expression of this gene may be associated with cancer cachexia in human patients.
• Form: Liquid
• AA Sequence: MSPTPGSEGHSAAPDCPSCALAALPKDVPNSQPEMVEAVKKHILNMLHLKKRPDVTQPVPKAALLNAIRKLHVGKVGENGYVEIEDDIGRRAEMNELMEQTSEIITFAESGTARKTLHFEISKEGSDLSVVERAEVWLFLKVPKANRTRTKVTIRLFQQQKHPQGSLDTGEEAEEVGLKGERSELLLSEKVVDARKSTWHVFPVSSSIQRLLDQGKSSLDVRIACEQCQESGASLVLLGKKKKKEEEGEGKKKGGGEGGAGADEEKEQSHRPFLMLQARQSEDHPHRRRRRGLXXXGLECDGKVNICCKKQFFVSFKDIGWNDWIIAPSGYHANYCEGECPSHIAGTSGSSLSFHSTVINHYRMRGHSPFANLKSCCVPTKLRPMSMLYYDDGQNIIKKDIQNMIVEECGCSXXX indicates position of His-tag.
• Purity: > 95% as determined by SDS-PAGE
• Storage: Stored and shipped at -80 centigrade
• Storage Buffer: PBS, pH 7.4

Gene Information

• Gene Name: INHBA inhibin, beta A [ Homo sapiens ]
• Official Symbol: INHBA
• Synonyms: INHBA; inhibin, beta A; inhibin, beta A (activin A, activin AB alpha polypeptide); inhibin beta A chain; Inhibin, beta-1; activin beta-A chain; FSH-releasing protein; erythroid differentiation factor; erythroid differentiation protein; follicle-stimulating hormone-releasing protein; EDF; FRP
• Gene ID: 3624
• mRNA Refseq: NM_002192
• Protein Refseq: NP_002183
• MIM: 147290
• UniProt ID: P08476