Recombinant Human INHBA Protein (AA 21-426), N-GFP/His-Tagged

Cat.No. : INHBA-32H
Product Overview : Recombinant Human INHBA Protein (AA 21-426) with N-GFP/His tag was expressed in HEK293.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : GFP&His
Protein Length : AA 21-426
Description : This gene encodes a member of the TGF-beta (transforming growth factor-beta) superfamily of proteins. The encoded preproprotein is proteolytically processed to generate a subunit of the dimeric activin and inhibin protein complexes. These complexes activate and inhibit, respectively, follicle stimulating hormone secretion from the pituitary gland. The encoded protein also plays a role in eye, tooth and testis development. Elevated expression of this gene may be associated with cancer cachexia in human patients.
Form : Liquid
AA Sequence : MSPTPGSEGHSAAPDCPSCALAALPKDVPNSQPEMVEAVKKHILNMLHLKKRPDVTQPVPKAALLNAIRKLHVGKVGENGYVEIEDDIGRRAEMNELMEQTSEIITFAESGTARKTLHFEISKEGSDLSVVERAEVWLFLKVPKANRTRTKVTIRLFQQQKHPQGSLDTGEEAEEVGLKGERSELLLSEKVVDARKSTWHVFPVSSSIQRLLDQGKSSLDVRIACEQCQESGASLVLLGKKKKKEEEGEGKKKGGGEGGAGADEEKEQSHRPFLMLQARQSEDHPHRRRRRGLXXXGLECDGKVNICCKKQFFVSFKDIGWNDWIIAPSGYHANYCEGECPSHIAGTSGSSLSFHSTVINHYRMRGHSPFANLKSCCVPTKLRPMSMLYYDDGQNIIKKDIQNMIVEECGCSXXX indicates position of His-tag.
Purity : > 95% as determined by SDS-PAGE
Storage : Stored and shipped at -80 centigrade
Storage Buffer : PBS, pH 7.4
Gene Name INHBA inhibin, beta A [ Homo sapiens ]
Official Symbol INHBA
Synonyms INHBA; inhibin, beta A; inhibin, beta A (activin A, activin AB alpha polypeptide); inhibin beta A chain; Inhibin, beta-1; activin beta-A chain; FSH-releasing protein; erythroid differentiation factor; erythroid differentiation protein; follicle-stimulating hormone-releasing protein; EDF; FRP
Gene ID 3624
mRNA Refseq NM_002192
Protein Refseq NP_002183
MIM 147290
UniProt ID P08476

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All INHBA Products

Required fields are marked with *

My Review for All INHBA Products

Required fields are marked with *

0
cart-icon
0
compare icon