Recombinant Human INHBE protein, His-tagged
Cat.No. : | INHBE-5523H |
Product Overview : | Recombinant Human INHBE protein(P58166)(237-350aa), fused with C-terminal His tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 237-350a.a. |
Tag : | His |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 19.4 kDa |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
AA Sequence : | TPTCEPATPLCCRRDHYVDFQELGWRDWILQPEGYQLNYCSGQCPPHLAGSPGIAASFHSAVFSLLKANNPWPASTSCCVPTARRPLSLLYLDHNGNVVKTDVPDMVVEACGCS |
Gene Name | INHBE inhibin, beta E [ Homo sapiens ] |
Official Symbol | INHBE |
Synonyms | INHBE; inhibin, beta E; inhibin beta E chain; activin; MGC4638; activin beta E; activin beta-E chain; |
Gene ID | 83729 |
mRNA Refseq | NM_031479 |
Protein Refseq | NP_113667 |
MIM | 612031 |
UniProt ID | P58166 |
◆ Recombinant Proteins | ||
Inhbe-798M | Recombinant Mouse Inhbe protein, His & GST-tagged | +Inquiry |
INHBE-114H | Recombinant Human INHBE, His-tagged | +Inquiry |
INHBE-797H | Recombinant Human INHBE protein, His-tagged | +Inquiry |
INHBE-12H | Recombinant Human INHBE Protein, N-His tagged | +Inquiry |
INHBE-5523H | Recombinant Human INHBE protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
INHBE-5203HCL | Recombinant Human INHBE 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All INHBE Products
Required fields are marked with *
My Review for All INHBE Products
Required fields are marked with *