Recombinant Human INMT Protein, GST-tagged
| Cat.No. : | INMT-5114H |
| Product Overview : | Human INMT partial ORF ( NP_006765, 174 a.a. - 263 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | N-methylation of endogenous and xenobiotic compounds is a major method by which they are degraded. This gene encodes an enzyme that N-methylates indoles such as tryptamine. [provided by RefSeq |
| Molecular Mass : | 35.64 kDa |
| AA Sequence : | DAYRAALCNLASLLKPGGHLVTTVTLRLPSYMVGKREFSCVALEKGEVEQAVLDAGFDIEQLLHSPQSYSVTNAANNGVCCIVARKKPGP |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | INMT indolethylamine N-methyltransferase [ Homo sapiens ] |
| Official Symbol | INMT |
| Synonyms | INMT; indolethylamine N-methyltransferase; amine N-methyltransferase; nicotine N-methyltransferase; arylamine N-methyltransferase; indolamine N-methyltransferase; aromatic alkylamine N-methyltransferase; MGC125940; MGC125941; |
| Gene ID | 11185 |
| mRNA Refseq | NM_001199219 |
| Protein Refseq | NP_001186148 |
| MIM | 604854 |
| UniProt ID | O95050 |
| ◆ Recombinant Proteins | ||
| INMT-1184H | Recombinant Human INMT Protein, His (Fc)-Avi-tagged | +Inquiry |
| Inmt-3541M | Recombinant Mouse Inmt Protein, Myc/DDK-tagged | +Inquiry |
| INMT-8217M | Recombinant Mouse INMT Protein | +Inquiry |
| INMT-6553H | Recombinant Human INMT Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| INMT-104R | Recombinant Rat INMT Protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| INMT-347HCL | Recombinant Human INMT lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All INMT Products
Required fields are marked with *
My Review for All INMT Products
Required fields are marked with *
