Recombinant Rat INMT Protein, His-tagged

• Cat.No.: INMT-104R
• Product Overview: Recombinant Rat INMT Protein, fused to His-tag, was expressed in E.coli.

Specification

• Species: Rat
• Source: E.coli
• Tag: His
• Description: Predicted to enable N-methyltransferase activity; amine N-methyltransferase activity; and thioether S-methyltransferase activity. Predicted to be involved in amine metabolic process and methylation. Predicted to be active in cytosol. Orthologous to human INMT (indolethylamine N-methyltransferase).
• Form: 50mM Tris 300mM NaCl, pH 8.0.
• Molecular Mass: 31.7 kDa
• AA Sequence: MGSSHHHHHHSSGLVPRGSHMAGKVYMGGEDYEKEFTPKDYLTTFYSFDSGTVAEQEIVKFSLQNLYQTFSTGGVGGDVLIDIGSGPTIYQLLSACEVFREIIATDYTPQNLQELQKWLKKEPGAYDWSSIVQHVCELEGDRSRWQEKEAKLRRTVTRVLRCDVTKTPPLGSAQVPLADCVLTFLAMECACPDVDTYRAALRRLAGLLKPGGHLVTLVTLRFQHYMVGPKKFSGVYLEKETVEKAIQDAGFQVLRCNCVSLSYSEAYCVNDGLYFVVARKGPSA
• Purity: >90%
• Storage: Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
• Concentration: 0.6 mg/ml

Gene Information

• Gene Name: Inmt indolethylamine N-methyltransferase [ Rattus norvegicus (Norway rat) ]
• Official Symbol: INMT
• Synonyms: TEMT
• Gene ID: 368066
• mRNA Refseq: NM_001109022
• Protein Refseq: NP_001102492
• UniProt ID: D3ZNJ5