Recombinant Rat INMT Protein, His-tagged
Cat.No. : | INMT-104R |
Product Overview : | Recombinant Rat INMT Protein, fused to His-tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rat |
Source : | E.coli |
Tag : | His |
Description : | Predicted to enable N-methyltransferase activity; amine N-methyltransferase activity; and thioether S-methyltransferase activity. Predicted to be involved in amine metabolic process and methylation. Predicted to be active in cytosol. Orthologous to human INMT (indolethylamine N-methyltransferase). |
Form : | 50mM Tris 300mM NaCl, pH 8.0. |
Molecular Mass : | 31.7 kDa |
AA Sequence : | MGSSHHHHHHSSGLVPRGSHMAGKVYMGGEDYEKEFTPKDYLTTFYSFDSGTVAEQEIVKFSLQNLYQTFSTGGVGGDVLIDIGSGPTIYQLLSACEVFREIIATDYTPQNLQELQKWLKKEPGAYDWSSIVQHVCELEGDRSRWQEKEAKLRRTVTRVLRCDVTKTPPLGSAQVPLADCVLTFLAMECACPDVDTYRAALRRLAGLLKPGGHLVTLVTLRFQHYMVGPKKFSGVYLEKETVEKAIQDAGFQVLRCNCVSLSYSEAYCVNDGLYFVVARKGPSA |
Purity : | >90% |
Storage : | Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
Concentration : | 0.6 mg/ml |
Gene Name | Inmt indolethylamine N-methyltransferase [ Rattus norvegicus (Norway rat) ] |
Official Symbol | INMT |
Synonyms | TEMT |
Gene ID | 368066 |
mRNA Refseq | NM_001109022 |
Protein Refseq | NP_001102492 |
UniProt ID | D3ZNJ5 |
◆ Recombinant Proteins | ||
INMT-2272R | Recombinant Rhesus monkey INMT Protein, His-tagged | +Inquiry |
INMT-2093R | Recombinant Rhesus Macaque INMT Protein, His (Fc)-Avi-tagged | +Inquiry |
INMT-2399H | Recombinant Human INMT Protein, MYC/DDK-tagged | +Inquiry |
INMT-104R | Recombinant Rat INMT Protein, His-tagged | +Inquiry |
INMT-584H | Recombinant Human INMT Protein (1-263 aa), His-SUMO-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
INMT-347HCL | Recombinant Human INMT lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All INMT Products
Required fields are marked with *
My Review for All INMT Products
Required fields are marked with *