Recombinant Rat INMT Protein, His-tagged

Cat.No. : INMT-104R
Product Overview : Recombinant Rat INMT Protein, fused to His-tag, was expressed in E.coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Rat
Source : E.coli
Tag : His
Description : Predicted to enable N-methyltransferase activity; amine N-methyltransferase activity; and thioether S-methyltransferase activity. Predicted to be involved in amine metabolic process and methylation. Predicted to be active in cytosol. Orthologous to human INMT (indolethylamine N-methyltransferase).
Form : 50mM Tris 300mM NaCl, pH 8.0.
Molecular Mass : 31.7 kDa
AA Sequence : MGSSHHHHHHSSGLVPRGSHMAGKVYMGGEDYEKEFTPKDYLTTFYSFDSGTVAEQEIVKFSLQNLYQTFSTGGVGGDVLIDIGSGPTIYQLLSACEVFREIIATDYTPQNLQELQKWLKKEPGAYDWSSIVQHVCELEGDRSRWQEKEAKLRRTVTRVLRCDVTKTPPLGSAQVPLADCVLTFLAMECACPDVDTYRAALRRLAGLLKPGGHLVTLVTLRFQHYMVGPKKFSGVYLEKETVEKAIQDAGFQVLRCNCVSLSYSEAYCVNDGLYFVVARKGPSA
Purity : >90%
Storage : Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
Concentration : 0.6 mg/ml
Gene Name Inmt indolethylamine N-methyltransferase [ Rattus norvegicus (Norway rat) ]
Official Symbol INMT
Synonyms TEMT
Gene ID 368066
mRNA Refseq NM_001109022
Protein Refseq NP_001102492
UniProt ID D3ZNJ5

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All INMT Products

Required fields are marked with *

My Review for All INMT Products

Required fields are marked with *

0
cart-icon
0
compare icon