Recombinant Rat INMT Protein, His-tagged
| Cat.No. : | INMT-104R |
| Product Overview : | Recombinant Rat INMT Protein, fused to His-tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Rat |
| Source : | E.coli |
| Tag : | His |
| Description : | Predicted to enable N-methyltransferase activity; amine N-methyltransferase activity; and thioether S-methyltransferase activity. Predicted to be involved in amine metabolic process and methylation. Predicted to be active in cytosol. Orthologous to human INMT (indolethylamine N-methyltransferase). |
| Form : | 50mM Tris 300mM NaCl, pH 8.0. |
| Molecular Mass : | 31.7 kDa |
| AA Sequence : | MGSSHHHHHHSSGLVPRGSHMAGKVYMGGEDYEKEFTPKDYLTTFYSFDSGTVAEQEIVKFSLQNLYQTFSTGGVGGDVLIDIGSGPTIYQLLSACEVFREIIATDYTPQNLQELQKWLKKEPGAYDWSSIVQHVCELEGDRSRWQEKEAKLRRTVTRVLRCDVTKTPPLGSAQVPLADCVLTFLAMECACPDVDTYRAALRRLAGLLKPGGHLVTLVTLRFQHYMVGPKKFSGVYLEKETVEKAIQDAGFQVLRCNCVSLSYSEAYCVNDGLYFVVARKGPSA |
| Purity : | >90% |
| Storage : | Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
| Concentration : | 0.6 mg/ml |
| Gene Name | Inmt indolethylamine N-methyltransferase [ Rattus norvegicus (Norway rat) ] |
| Official Symbol | INMT |
| Synonyms | TEMT |
| Gene ID | 368066 |
| mRNA Refseq | NM_001109022 |
| Protein Refseq | NP_001102492 |
| UniProt ID | D3ZNJ5 |
| ◆ Recombinant Proteins | ||
| INMT-99R | Recombinant Rabbit INMT Protein, His-tagged | +Inquiry |
| INMT-2093R | Recombinant Rhesus Macaque INMT Protein, His (Fc)-Avi-tagged | +Inquiry |
| INMT-584H | Recombinant Human INMT Protein (1-263 aa), His-SUMO-tagged | +Inquiry |
| INMT-2400H | Recombinant Human INMT Protein, His-tagged | +Inquiry |
| INMT-2272R | Recombinant Rhesus monkey INMT Protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| INMT-347HCL | Recombinant Human INMT lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All INMT Products
Required fields are marked with *
My Review for All INMT Products
Required fields are marked with *
