Recombinant Human INPP1, His-tagged
Cat.No. : | INPP1-117H |
Product Overview : | Recombinant Human Inositol Polyphosphate 1-Phosphatase/INPP1 is produced by our mammalian expression system in human cells. The target protein is expressed with sequence (Met1-Thr399) of Human INPP1 fused with a polyhistidine tag at the C-terminus. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | His |
Protein Length : | 1-399 a.a. |
Description : | Inositol Polyphosphate 1-Phosphatase (INPP1) is a member of the inositol monophosphatase family. INPP1 is widely expressed in tissues, with highest expression levels observed in the pancreas and kidney. INPP1 is inhibited by Li+. Removing the phosphate group at position 1 of the inositol ring from the polyphosphates inositol 1,4-bisphosphate and inositol 1,3,4-trisphophosphate. INPP1 is involved in signal transduction and phosphatidylinositol signaling pathway. |
AA Sequence : | MSDILRELLCVSEKAANIARACRQQEALFQLLIEEKKEGEKNKKFAVDFKTLADVLVQEVIKQNM ENKFPGLEKNIFGEESNEFTNDWGEKITLRLCSTEEETAELLSKVLNGNKVASEALARVVHQDVA FTDPTLDSTEINVPQDILGIWVDPIDSTYQYIKGSADIKSNQGIFPCGLQCVTILIGVYDIQTGV PLMGVINQPFVSRDPNTLRWKGQCYWGLSYMGTNMHSLQLTISRRNGSETHTGNTGSEAAFSPSF SAVISTSEKETIKAALSRVCGDRIFGAAGAGYKSLCVVQGLVDIYIFSEDTTFKWDSCAAHAILR AMGGGIVDLKECLERNPETGLDLPQLVYHVENEGAAGVDRWANKGGLIAYRSRKRLETFLSLLVQ NLAPAETHTVDHHHHHH |
Endotoxin : | Less than 0.1 ng/μg (1 IEU/μg). |
Purity : | Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. |
Gene Name | INPP1 inositol polyphosphate-1-phosphatase [ Homo sapiens ] |
Official Symbol | INPP1 |
Synonyms | INPP1; inositol polyphosphate-1-phosphatase; inositol polyphosphate 1-phosphatase; IPP; IPPase; MGC110984; |
Gene ID | 3628 |
mRNA Refseq | NM_001128928 |
Protein Refseq | NP_001122400 |
MIM | 147263 |
UniProt ID | P49441 |
Chromosome Location | 2q32 |
Pathway | D-myo-inositol (1,4,5)-trisphosphate degradation, organism-specific biosystem; D-myo-inositol (1,4,5)-trisphosphate degradation, conserved biosystem; Inositol phosphate metabolism, organism-specific biosystem; Inositol phosphate metabolism, conserved biosystem; Inositol phosphate metabolism, Ins(1,3,4,5)P4 => Ins(1,3,4)P3 => myo-inositol, organism-specific biosystem; |
Function | hydrolase activity; inositol-1,4-bisphosphate 1-phosphatase activity; metal ion binding; |
◆ Recombinant Proteins | ||
Inpp1-3543M | Recombinant Mouse Inpp1 Protein, Myc/DDK-tagged | +Inquiry |
INPP1-8223M | Recombinant Mouse INPP1 Protein | +Inquiry |
INPP1-5112H | Recombinant Human INPP1 Protein, GST-tagged | +Inquiry |
INPP1-117H | Recombinant Human INPP1, His-tagged | +Inquiry |
INPP1-2728H | Recombinant Human INPP1 Protein (Met1-Thr399), C-His tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
INPP1-5200HCL | Recombinant Human INPP1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All INPP1 Products
Required fields are marked with *
My Review for All INPP1 Products
Required fields are marked with *