Recombinant Human INPP1, His-tagged

Cat.No. : INPP1-117H
Product Overview : Recombinant Human Inositol Polyphosphate 1-Phosphatase/INPP1 is produced by our mammalian expression system in human cells. The target protein is expressed with sequence (Met1-Thr399) of Human INPP1 fused with a polyhistidine tag at the C-terminus.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : His
Protein Length : 1-399 a.a.
Description : Inositol Polyphosphate 1-Phosphatase (INPP1) is a member of the inositol monophosphatase family. INPP1 is widely expressed in tissues, with highest expression levels observed in the pancreas and kidney. INPP1 is inhibited by Li+. Removing the phosphate group at position 1 of the inositol ring from the polyphosphates inositol 1,4-bisphosphate and inositol 1,3,4-trisphophosphate. INPP1 is involved in signal transduction and phosphatidylinositol signaling pathway.
AA Sequence : MSDILRELLCVSEKAANIARACRQQEALFQLLIEEKKEGEKNKKFAVDFKTLADVLVQEVIKQNM ENKFPGLEKNIFGEESNEFTNDWGEKITLRLCSTEEETAELLSKVLNGNKVASEALARVVHQDVA FTDPTLDSTEINVPQDILGIWVDPIDSTYQYIKGSADIKSNQGIFPCGLQCVTILIGVYDIQTGV PLMGVINQPFVSRDPNTLRWKGQCYWGLSYMGTNMHSLQLTISRRNGSETHTGNTGSEAAFSPSF SAVISTSEKETIKAALSRVCGDRIFGAAGAGYKSLCVVQGLVDIYIFSEDTTFKWDSCAAHAILR AMGGGIVDLKECLERNPETGLDLPQLVYHVENEGAAGVDRWANKGGLIAYRSRKRLETFLSLLVQ NLAPAETHTVDHHHHHH
Endotoxin : Less than 0.1 ng/μg (1 IEU/μg).
Purity : Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
Gene Name INPP1 inositol polyphosphate-1-phosphatase [ Homo sapiens ]
Official Symbol INPP1
Synonyms INPP1; inositol polyphosphate-1-phosphatase; inositol polyphosphate 1-phosphatase; IPP; IPPase; MGC110984;
Gene ID 3628
mRNA Refseq NM_001128928
Protein Refseq NP_001122400
MIM 147263
UniProt ID P49441
Chromosome Location 2q32
Pathway D-myo-inositol (1,4,5)-trisphosphate degradation, organism-specific biosystem; D-myo-inositol (1,4,5)-trisphosphate degradation, conserved biosystem; Inositol phosphate metabolism, organism-specific biosystem; Inositol phosphate metabolism, conserved biosystem; Inositol phosphate metabolism, Ins(1,3,4,5)P4 => Ins(1,3,4)P3 => myo-inositol, organism-specific biosystem;
Function hydrolase activity; inositol-1,4-bisphosphate 1-phosphatase activity; metal ion binding;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All INPP1 Products

Required fields are marked with *

My Review for All INPP1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon