Recombinant Human INPP4B Protein, GST-tagged

Cat.No. : INPP4B-5109H
Product Overview : Human INPP4B full-length ORF ( AAH05273, 1 a.a. - 53 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : INPP4B encodes the inositol polyphosphate 4-phosphatase type II, one of the enzymes involved in phosphatidylinositol signaling pathways. This enzyme removes the phosphate group at position 4 of the inositol ring from inositol 3,4-bisphosphate. There is limited data to suggest that the human type II enzyme is subject to alternative splicing, as has been established for the type I enzyme. [provided by RefSeq
Molecular Mass : 31.57 kDa
AA Sequence : MEIKEEGASEEGQHFLPTAQANDPGDCQFTSIQKTPNEPQLEFILDLNQELRD
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name INPP4B inositol polyphosphate-4-phosphatase, type II, 105kDa [ Homo sapiens ]
Official Symbol INPP4B
Synonyms INPP4B; inositol polyphosphate-4-phosphatase, type II, 105kDa; inositol polyphosphate 4 phosphatase, type II, 105kD; type II inositol 3,4-bisphosphate 4-phosphatase; inositol polyphosphate 4-phosphatase type II; type II inositol-3,4-bisphosphate 4-phosphatase; inositol polyphosphate 4-phosphatase II; 4-phosphatase II; MGC132014;
Gene ID 8821
mRNA Refseq NM_001101669
Protein Refseq NP_001095139
MIM 607494
UniProt ID O15327

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All INPP4B Products

Required fields are marked with *

My Review for All INPP4B Products

Required fields are marked with *

0

Inquiry Basket

cartIcon