Recombinant Human INPP5A

• Cat.No.: INPP5A-27622TH
• Product Overview: Recombinant fragmentcorresponding to aa 288-387 of Human INPP5A with N terminal proprietary tag; Q14642,

Specification

• Species: Human
• Source: Wheat Germ
• Tag: Non
• Protein Length: 100 amino acids
• Description: The protein encoded by this gene is a membrane-associated type I inositol 1,4,5-trisphosphate (InsP3) 5-phosphatase. InsP3 5-phosphatases hydrolyze Ins(1,4,5)P3, which mobilizes intracellular calcium and acts as a second messenger mediating cell responses to various stimulation.
• Molecular Weight: 36.630kDa inclusive of tags
• Tissue specificity: Brain; high level in Purkinje cells.
• Form: Liquid
• Purity: Proprietary Purification
• Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: YFNQEVFRDNNGTALLEFDKELSVFKDRLYELDISFPPSYPYSEDARQGEQYMNTRCPAWCDRILMSPSAKELVLRVSVCCPSPGHRGMWSAGSGLAQPW
• Sequence Similarities: Belongs to the inositol-1,4,5-trisphosphate 5-phosphatase type I family.

Gene Information

• Gene Name: INPP5A inositol polyphosphate-5-phosphatase, 40kDa [ Homo sapiens ]
• Official Symbol: INPP5A
• Synonyms: INPP5A; inositol polyphosphate-5-phosphatase, 40kDa; inositol polyphosphate 5 phosphatase, 40kD; type I inositol-1,4,5-trisphosphate 5-phosphatase; 5PTASE; 43 kDa inositol polyphosphate 5 phophatase; CTCL tumor antigen HD CL 02; inositol polyphosphate 5 p
• Gene ID: 3632
• mRNA Refseq: NM_005539
• Protein Refseq: NP_005530
• MIM: 600106
• Uniprot ID: Q14642
• Chromosome Location: 10q26.3
• Pathway: 1D-myo-inositol hexakisphosphate biosynthesis II (mammalian), conserved biosystem; D-myo-inositol (1,3,4)-trisphosphate biosynthesis, conserved biosystem; D-myo-inositol (1,4,5)-trisphosphate degradation, conserved biosystem; Inositol phosphate metabolism, organism-specific biosystem; Inositol phosphate metabolism, conserved biosystem
• Function: PH domain binding; hydrolase activity; inositol 1,3,4,5-tetrakisphosphate 5-phosphatase activity; inositol-1,4,5-trisphosphate 5-phosphatase activity; inositol-polyphosphate 5-phosphatase activity