Recombinant Human INPP5A
| Cat.No. : | INPP5A-27622TH |
| Product Overview : | Recombinant fragmentcorresponding to aa 288-387 of Human INPP5A with N terminal proprietary tag; Q14642, |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | Non |
| Protein Length : | 100 amino acids |
| Description : | The protein encoded by this gene is a membrane-associated type I inositol 1,4,5-trisphosphate (InsP3) 5-phosphatase. InsP3 5-phosphatases hydrolyze Ins(1,4,5)P3, which mobilizes intracellular calcium and acts as a second messenger mediating cell responses to various stimulation. |
| Molecular Weight : | 36.630kDa inclusive of tags |
| Tissue specificity : | Brain; high level in Purkinje cells. |
| Form : | Liquid |
| Purity : | Proprietary Purification |
| Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
| Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
| Sequences of amino acids : | YFNQEVFRDNNGTALLEFDKELSVFKDRLYELDISFPPSYPYSEDARQGEQYMNTRCPAWCDRILMSPSAKELVLRVSVCCPSPGHRGMWSAGSGLAQPW |
| Sequence Similarities : | Belongs to the inositol-1,4,5-trisphosphate 5-phosphatase type I family. |
| Gene Name | INPP5A inositol polyphosphate-5-phosphatase, 40kDa [ Homo sapiens ] |
| Official Symbol | INPP5A |
| Synonyms | INPP5A; inositol polyphosphate-5-phosphatase, 40kDa; inositol polyphosphate 5 phosphatase, 40kD; type I inositol-1,4,5-trisphosphate 5-phosphatase; 5PTASE; 43 kDa inositol polyphosphate 5 phophatase; CTCL tumor antigen HD CL 02; inositol polyphosphate 5 p |
| Gene ID | 3632 |
| mRNA Refseq | NM_005539 |
| Protein Refseq | NP_005530 |
| MIM | 600106 |
| Uniprot ID | Q14642 |
| Chromosome Location | 10q26.3 |
| Pathway | 1D-myo-inositol hexakisphosphate biosynthesis II (mammalian), conserved biosystem; D-myo-inositol (1,3,4)-trisphosphate biosynthesis, conserved biosystem; D-myo-inositol (1,4,5)-trisphosphate degradation, conserved biosystem; Inositol phosphate metabolism, organism-specific biosystem; Inositol phosphate metabolism, conserved biosystem; |
| Function | PH domain binding; hydrolase activity; inositol 1,3,4,5-tetrakisphosphate 5-phosphatase activity; inositol-1,4,5-trisphosphate 5-phosphatase activity; inositol-polyphosphate 5-phosphatase activity; |
| ◆ Recombinant Proteins | ||
| INPP5A-5108H | Recombinant Human INPP5A Protein, GST-tagged | +Inquiry |
| Inpp5a-3546M | Recombinant Mouse Inpp5a Protein, Myc/DDK-tagged | +Inquiry |
| INPP5A-013H | Recombinant Human INPP5A Protein, His-tagged | +Inquiry |
| INPP5A-27622TH | Recombinant Human INPP5A | +Inquiry |
| INPP5A-012H | Recombinant Human INPP5A protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| INPP5A-5199HCL | Recombinant Human INPP5A 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All INPP5A Products
Required fields are marked with *
My Review for All INPP5A Products
Required fields are marked with *


