Recombinant Human INPP5A

Cat.No. : INPP5A-27622TH
Product Overview : Recombinant fragmentcorresponding to aa 288-387 of Human INPP5A with N terminal proprietary tag; Q14642,
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 100 amino acids
Description : The protein encoded by this gene is a membrane-associated type I inositol 1,4,5-trisphosphate (InsP3) 5-phosphatase. InsP3 5-phosphatases hydrolyze Ins(1,4,5)P3, which mobilizes intracellular calcium and acts as a second messenger mediating cell responses to various stimulation.
Molecular Weight : 36.630kDa inclusive of tags
Tissue specificity : Brain; high level in Purkinje cells.
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : YFNQEVFRDNNGTALLEFDKELSVFKDRLYELDISFPPSYPYSEDARQGEQYMNTRCPAWCDRILMSPSAKELVLRVSVCCPSPGHRGMWSAGSGLAQPW
Sequence Similarities : Belongs to the inositol-1,4,5-trisphosphate 5-phosphatase type I family.
Gene Name INPP5A inositol polyphosphate-5-phosphatase, 40kDa [ Homo sapiens ]
Official Symbol INPP5A
Synonyms INPP5A; inositol polyphosphate-5-phosphatase, 40kDa; inositol polyphosphate 5 phosphatase, 40kD; type I inositol-1,4,5-trisphosphate 5-phosphatase; 5PTASE; 43 kDa inositol polyphosphate 5 phophatase; CTCL tumor antigen HD CL 02; inositol polyphosphate 5 p
Gene ID 3632
mRNA Refseq NM_005539
Protein Refseq NP_005530
MIM 600106
Uniprot ID Q14642
Chromosome Location 10q26.3
Pathway 1D-myo-inositol hexakisphosphate biosynthesis II (mammalian), conserved biosystem; D-myo-inositol (1,3,4)-trisphosphate biosynthesis, conserved biosystem; D-myo-inositol (1,4,5)-trisphosphate degradation, conserved biosystem; Inositol phosphate metabolism, organism-specific biosystem; Inositol phosphate metabolism, conserved biosystem;
Function PH domain binding; hydrolase activity; inositol 1,3,4,5-tetrakisphosphate 5-phosphatase activity; inositol-1,4,5-trisphosphate 5-phosphatase activity; inositol-polyphosphate 5-phosphatase activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All INPP5A Products

Required fields are marked with *

My Review for All INPP5A Products

Required fields are marked with *

0
cart-icon
0
compare icon