Recombinant Human INPPL1 Protein, GST-tagged

• Cat.No.: INPPL1-5101H
• Product Overview: Human INPPL1 partial ORF ( NP_001558, 1159 a.a. - 1258 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: The protein encoded by this gene is an SH2-containing 5-inositol phosphatase that is involved in the regulation of insulin function. The encoded protein also plays a role in the regulation of epidermal growth factor receptor turnover and actin remodelling. Additionally, this gene supports metastatic growth in breast cancer and is a valuable biomarker for breast cancer. [provided by RefSeq
• Molecular Mass: 36.74 kDa
• AA Sequence: PSDYGRPLSFPPPRIRESIQEDLAEEAPCLQGGRASGLGEAGMSAWLRAIGLERYEEGLVHNGWDDLEFLSDITEEDLEEAGVQDPAHKRLLLDTLQLSK
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: INPPL1 inositol polyphosphate phosphatase-like 1 [ Homo sapiens ]
• Official Symbol: INPPL1
• Synonyms: INPPL1; inositol polyphosphate phosphatase-like 1; phosphatidylinositol 3,4,5-trisphosphate 5-phosphatase 2; 51C protein; SHIP2; SHIP-2; INPPL-1; protein 51C; SH2 domain-containing inositol 5-phosphatase 2; SH2 domain-containing inositol-5-phosphatase 2; phosphatidylinositol-3,4,5-trisphosphate 5-phosphatase 2
• Gene ID: 3636
• mRNA Refseq: NM_001567
• Protein Refseq: NP_001558
• MIM: 600829
• UniProt ID: O15357