Recombinant Human INPPL1 Protein, GST-tagged

Cat.No. : INPPL1-5101H
Product Overview : Human INPPL1 partial ORF ( NP_001558, 1159 a.a. - 1258 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : The protein encoded by this gene is an SH2-containing 5-inositol phosphatase that is involved in the regulation of insulin function. The encoded protein also plays a role in the regulation of epidermal growth factor receptor turnover and actin remodelling. Additionally, this gene supports metastatic growth in breast cancer and is a valuable biomarker for breast cancer. [provided by RefSeq
Molecular Mass : 36.74 kDa
AA Sequence : PSDYGRPLSFPPPRIRESIQEDLAEEAPCLQGGRASGLGEAGMSAWLRAIGLERYEEGLVHNGWDDLEFLSDITEEDLEEAGVQDPAHKRLLLDTLQLSK
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name INPPL1 inositol polyphosphate phosphatase-like 1 [ Homo sapiens ]
Official Symbol INPPL1
Synonyms INPPL1; inositol polyphosphate phosphatase-like 1; phosphatidylinositol 3,4,5-trisphosphate 5-phosphatase 2; 51C protein; SHIP2; SHIP-2; INPPL-1; protein 51C; SH2 domain-containing inositol 5-phosphatase 2; SH2 domain-containing inositol-5-phosphatase 2; phosphatidylinositol-3,4,5-trisphosphate 5-phosphatase 2;
Gene ID 3636
mRNA Refseq NM_001567
Protein Refseq NP_001558
MIM 600829
UniProt ID O15357

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All INPPL1 Products

Required fields are marked with *

My Review for All INPPL1 Products

Required fields are marked with *

0
cart-icon