Recombinant Human INSR Protein, His-SUMO-tagged
| Cat.No. : | INSR-1260H |
| Product Overview : | Recombinant Human INSR Protein (1023-1298aa) was expressed in E. coli with N-terminal His-SUMO tag. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His&SUMO |
| Protein Length : | 1023-1298 a.a. |
| Form : | Tris-based buffer, 50% glycerol. |
| Molecular Mass : | 47.2 kDa |
| AA Sequence : | ITLLRELGQGSFGMVYEGNARDIIKGEAETRVAVKTVNESASLRERIEFLNEASVMKGFTCHHVVRLLGVVSKGQPTLVVMELMAHGDLKSYLRSLRPEAENNPGRPPPTLQEMIQMAAEIADGMAYLNAKKFVHRDLAARNCMVAHDFTVKIGDFGMTRDIYETDYYRKGGKGLLPVRWMAPESLKDGVFTTSSDMWSFGVVLWEITSLAEQPYQGLSNEQVLKFVMDGGYLDQPDNCPERVTDLMRMCWQFNPKMRPTFLEIVNLLKDDLHPSF |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | The shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
| Gene Name | INSR insulin receptor [Homo sapiens] |
| Official Symbol | INSR |
| Synonyms | INSR; insulin receptor; HHF5; CD220; EC 2.7.10.1; IR; CD220 antigen; Insulin receptor subunit alpha; Insulin receptor subunit beta |
| Gene ID | 3643 |
| mRNA Refseq | NM_000208 |
| Protein Refseq | NP_000199 |
| MIM | 147670 |
| UniProt ID | P06213 |
| ◆ Recombinant Proteins | ||
| INSR-2566H | Recombinant Human INSR protein(601-750 aa), C-hFc & C-His-tagged | +Inquiry |
| INSR-29H | Recombinant Human INSR protein, His-tagged | +Inquiry |
| RFL30439RF | Recombinant Full Length Rat Insulin Receptor(Insr) Protein, His-Tagged | +Inquiry |
| INSR-1604R | Recombinant Rhesus Monkey INSR Protein | +Inquiry |
| RFL3292HF | Recombinant Full Length Human Insulin Receptor(Insr) Protein, His-Tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| INSR-2648HCL | Recombinant Human INSR cell lysate | +Inquiry |
| INSR-474HCL | Recombinant Human INSR cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All INSR Products
Required fields are marked with *
My Review for All INSR Products
Required fields are marked with *
