Recombinant Human INSR Protein, His-SUMO-tagged

Cat.No. : INSR-1260H
Product Overview : Recombinant Human INSR Protein (1023-1298aa) was expressed in E. coli with N-terminal His-SUMO tag.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His&SUMO
Protein Length : 1023-1298 a.a.
Form : Tris-based buffer, 50% glycerol.
Molecular Mass : 47.2 kDa
AA Sequence : ITLLRELGQGSFGMVYEGNARDIIKGEAETRVAVKTVNESASLRERIEFLNEASVMKGFTCHHVVRLLGVVSKGQPTLVVMELMAHGDLKSYLRSLRPEAENNPGRPPPTLQEMIQMAAEIADGMAYLNAKKFVHRDLAARNCMVAHDFTVKIGDFGMTRDIYETDYYRKGGKGLLPVRWMAPESLKDGVFTTSSDMWSFGVVLWEITSLAEQPYQGLSNEQVLKFVMDGGYLDQPDNCPERVTDLMRMCWQFNPKMRPTFLEIVNLLKDDLHPSF
Purity : Greater than 90% as determined by SDS-PAGE.
Storage : The shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Gene Name INSR insulin receptor [Homo sapiens]
Official Symbol INSR
Synonyms INSR; insulin receptor; HHF5; CD220; EC 2.7.10.1; IR; CD220 antigen; Insulin receptor subunit alpha; Insulin receptor subunit beta
Gene ID 3643
mRNA Refseq NM_000208
Protein Refseq NP_000199
MIM 147670
UniProt ID P06213

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All INSR Products

Required fields are marked with *

My Review for All INSR Products

Required fields are marked with *

0

Inquiry Basket

cartIcon