"INSR" Related Products

Expand
Expand

Recombinant Human INSR Protein, His-SUMO-tagged

Cat.No.: INSR-1260H
Product Overview: Recombinant Human INSR Protein (1023-1298aa) was expressed in E. coli with N-terminal His-SUMO tag.
Source: E. coli
Species: Human
Tag : His-SUMO
Form: Tris-based buffer, 50% glycerol.
Molecular Mass: 47.2 kDa
AA Sequence: ITLLRELGQGSFGMVYEGNARDIIKGEAETRVAVKTVNESASLRERIEFLNEASVMKGFTCHHVVRLLGVVSKGQPTLVVMELMAHGDLKSYLRSLRPEAENNPGRPPPTLQEMIQMAAEIADGMAYLNAKKFVHRDLAARNCMVAHDFTVKIGDFGMTRDIYETDYYRKGGKGLLPVRWMAPESLKDGVFTTSSDMWSFGVVLWEITSLAEQPYQGLSNEQVLKFVMDGGYLDQPDNCPERVTDLMRMCWQFNPKMRPTFLEIVNLLKDDLHPSF
Purity: Greater than 90% as determined by SDS-PAGE.
Storage: The shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Gene Name: INSR insulin receptor [Homo sapiens]
Official Symbol: INSR
Synonyms: INSR; insulin receptor; HHF5; CD220; EC 2.7.10.1; IR; CD220 antigen; Insulin receptor subunit alpha; Insulin receptor subunit beta
Gene ID: 3643
mRNA Refseq: NM_000208
Protein Refseq: NP_000199
MIM: 147670
UniProt ID: P06213

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.