Recombinant Human INTS6 Protein, GST-tagged
Cat.No. : | INTS6-2479H |
Product Overview : | Human DDX26 partial ORF ( NP_036273, 779 a.a. - 887 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. The protein encoded by this gene is a DEAD box protein that is part of a complex that interacts with the C-terminus of RNA polymerase II and is involved in 3' end processing of snRNAs. In addition, this gene is a candidate tumor suppressor and is located in the critical region of loss of heterozygosity (LOH). Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Apr 2015] |
Molecular Mass : | 37.73 kDa |
AA Sequence : | DKEQCAEENIPASSLNKGKKLMHCRSHEEVNTELKAQIMKEIRKPGRKYERIFTLLKHVQGSLQTRLIFLQNVIKEASRFKKRMLIEQLENFLDEIHRRANQINHINSN |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | INTS6 integrator complex subunit 6 [ Homo sapiens ] |
Official Symbol | INTS6 |
Synonyms | INTS6; integrator complex subunit 6; DDX26, DEAD/H (Asp Glu Ala Asp/His) box polypeptide 26; DBI 1; DDX26A; DICE1; HDB; INT6; Notchl2; DEAD box protein; RNA helicase HDB; protein deleted in cancer 1; DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide 26; DBI-1; DDX26; DKFZp434B105; |
Gene ID | 26512 |
mRNA Refseq | NM_001039937 |
Protein Refseq | NP_001035026 |
MIM | 604331 |
UniProt ID | Q9UL03 |
◆ Recombinant Proteins | ||
INTS6-4570M | Recombinant Mouse INTS6 Protein, His (Fc)-Avi-tagged | +Inquiry |
INTS6-2479H | Recombinant Human INTS6 Protein, GST-tagged | +Inquiry |
INTS6-6732Z | Recombinant Zebrafish INTS6 | +Inquiry |
INTS6-8250M | Recombinant Mouse INTS6 Protein | +Inquiry |
INTS6-481H | Recombinant Human INTS6 Protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All INTS6 Products
Required fields are marked with *
My Review for All INTS6 Products
Required fields are marked with *