Recombinant Human IP6K2 protein, His-tagged
Cat.No. : | IP6K2-3315H |
Product Overview : | Recombinant Human IP6K2 protein(1-350 aa), fused to His tag, was expressed in E. coli. |
Availability | October 16, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-350 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | MSPAFRAMDVEPRAKGVLLEPFVHQVGGHSCVLRFNETTLCKPLVPREHQFYETLPAEMRKFTPQYKGVVSVRFEEDEDRNLCLIAYPLKGDHGIVDIVDNSDCEPKSKLLRWTTNKKHHVLETEKTPKDWVRQHRKEEKMKSHKLEEEFEWLKKSEVLYYTVEKKGNISSQLKHYNPWSMKCHQQQLQRMKENAKHRNQYKFILLENLTSRYEVPCVLDLKMGTRQHGDDASEEKAANQIRKCQQSTSAVIGVRVCGMQVYQAGSGQLMFMNKYHGRKLSVQGFKEALFQFFHNGRYLRRELLGPVLKKLTELKAVLERQESYRFYSSSLLVIYDGKERPEVVLDSDAE |
Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | IP6K2 inositol hexakisphosphate kinase 2 [ Homo sapiens ] |
Official Symbol | IP6K2 |
Synonyms | IP6K2; inositol hexakisphosphate kinase 2; IHPK2, inositol hexaphosphate kinase 2; insp6 kinase 2; pi uptake stimulator; inositol hexaphosphate kinase 2; ATP:1D-myo-inositol-hexakisphosphate phosphotransferase; PIUS; IHPK2; |
Gene ID | 51447 |
mRNA Refseq | NM_001005909 |
Protein Refseq | NP_001005909 |
MIM | 606992 |
UniProt ID | Q9UHH9 |
◆ Recombinant Proteins | ||
Ip6k2-1688M | Recombinant Mouse Ip6k2 Protein, His-tagged | +Inquiry |
IP6K2-3085R | Recombinant Rat IP6K2 Protein | +Inquiry |
IP6K2-2332H | Recombinant Human IP6K2 Protein, His-tagged | +Inquiry |
IP6K2-3315H | Recombinant Human IP6K2 protein, His-tagged | +Inquiry |
IP6K2-8257M | Recombinant Mouse IP6K2 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
IP6K2-5186HCL | Recombinant Human IP6K2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All IP6K2 Products
Required fields are marked with *
My Review for All IP6K2 Products
Required fields are marked with *