Recombinant Human IP6K2 protein, His-tagged
| Cat.No. : | IP6K2-3315H |
| Product Overview : | Recombinant Human IP6K2 protein(1-350 aa), fused to His tag, was expressed in E. coli. |
| Availability | December 07, 2025 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 1-350 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
| AA Sequence : | MSPAFRAMDVEPRAKGVLLEPFVHQVGGHSCVLRFNETTLCKPLVPREHQFYETLPAEMRKFTPQYKGVVSVRFEEDEDRNLCLIAYPLKGDHGIVDIVDNSDCEPKSKLLRWTTNKKHHVLETEKTPKDWVRQHRKEEKMKSHKLEEEFEWLKKSEVLYYTVEKKGNISSQLKHYNPWSMKCHQQQLQRMKENAKHRNQYKFILLENLTSRYEVPCVLDLKMGTRQHGDDASEEKAANQIRKCQQSTSAVIGVRVCGMQVYQAGSGQLMFMNKYHGRKLSVQGFKEALFQFFHNGRYLRRELLGPVLKKLTELKAVLERQESYRFYSSSLLVIYDGKERPEVVLDSDAE |
| Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
| Gene Name | IP6K2 inositol hexakisphosphate kinase 2 [ Homo sapiens ] |
| Official Symbol | IP6K2 |
| Synonyms | IP6K2; inositol hexakisphosphate kinase 2; IHPK2, inositol hexaphosphate kinase 2; insp6 kinase 2; pi uptake stimulator; inositol hexaphosphate kinase 2; ATP:1D-myo-inositol-hexakisphosphate phosphotransferase; PIUS; IHPK2; |
| Gene ID | 51447 |
| mRNA Refseq | NM_001005909 |
| Protein Refseq | NP_001005909 |
| MIM | 606992 |
| UniProt ID | Q9UHH9 |
| ◆ Recombinant Proteins | ||
| IP6K2-11516Z | Recombinant Zebrafish IP6K2 | +Inquiry |
| IP6K2-503H | Recombinant Human IP6K2 Protein, His-tagged | +Inquiry |
| IP6K2-3315H | Recombinant Human IP6K2 protein, His-tagged | +Inquiry |
| Ip6k2-1688M | Recombinant Mouse Ip6k2 Protein, His-tagged | +Inquiry |
| IP6K2-2309C | Recombinant Chicken IP6K2 | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| IP6K2-5186HCL | Recombinant Human IP6K2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All IP6K2 Products
Required fields are marked with *
My Review for All IP6K2 Products
Required fields are marked with *
