Recombinant Human IPPK Protein, GST-Tagged

• Cat.No.: IPPK-1310H
• Product Overview: Human C9orf12 partial ORF (NP_073592, 391 a.a. - 491 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: The protein encoded by this gene is a kinase that phosphorylates position 2 of inositol-1,3,4,5,6-pentakisphosphate to form inositol-1,2,3,4,5,6-hexakisphosphate (InsP6). InsP6 has a variety of functions, including stimulation of DNA repair, endocytosis, and mRNA export. [provided by RefSeq, Nov 2010]
• Molecular Mass: 36.85 kDa
• AA Sequence: VQQYRVAMTAKDCSIMIALSPCLQDASSDQRPVVPSSRSRFAFSVSVLDLDLKPYESIPHQYKLDGKIVNYYSKTVRAKDNAVMSTRFKESEDCTLVLHKV
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: IPPK inositol 1,3,4,5,6-pentakisphosphate 2-kinase [ Homo sapiens ]
• Official Symbol: IPPK
• Synonyms: IPPK; inositol 1,3,4,5,6-pentakisphosphate 2-kinase; C9orf12, chromosome 9 open reading frame 12; inositol-pentakisphosphate 2-kinase; FLJ13163; INSP5K2; IP5K; IPK1; IPK1 homolog; insP5 2-kinase; ins(1,3,4,5,6)P5 2-kinase; bA476B13.1 (novel protein); C9orf12; bA476B13.1; KIAA0699
• Gene ID: 64768
• mRNA Refseq: NM_022755
• Protein Refseq: NP_073592
• UniProt ID: Q9H8X2