Recombinant Human IPPK Protein, GST-Tagged

Cat.No. : IPPK-1310H
Product Overview : Human C9orf12 partial ORF (NP_073592, 391 a.a. - 491 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : The protein encoded by this gene is a kinase that phosphorylates position 2 of inositol-1,3,4,5,6-pentakisphosphate to form inositol-1,2,3,4,5,6-hexakisphosphate (InsP6). InsP6 has a variety of functions, including stimulation of DNA repair, endocytosis, and mRNA export. [provided by RefSeq, Nov 2010]
Molecular Mass : 36.85 kDa
AA Sequence : VQQYRVAMTAKDCSIMIALSPCLQDASSDQRPVVPSSRSRFAFSVSVLDLDLKPYESIPHQYKLDGKIVNYYSKTVRAKDNAVMSTRFKESEDCTLVLHKV
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name IPPK inositol 1,3,4,5,6-pentakisphosphate 2-kinase [ Homo sapiens ]
Official Symbol IPPK
Synonyms IPPK; inositol 1,3,4,5,6-pentakisphosphate 2-kinase; C9orf12, chromosome 9 open reading frame 12; inositol-pentakisphosphate 2-kinase; FLJ13163; INSP5K2; IP5K; IPK1; IPK1 homolog; insP5 2-kinase; ins(1,3,4,5,6)P5 2-kinase; bA476B13.1 (novel protein); C9orf12; bA476B13.1; KIAA0699;
Gene ID 64768
mRNA Refseq NM_022755
Protein Refseq NP_073592
UniProt ID Q9H8X2

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All IPPK Products

Required fields are marked with *

My Review for All IPPK Products

Required fields are marked with *

0
cart-icon
0
compare icon