Recombinant Human IPPK Protein, GST-Tagged
Cat.No. : | IPPK-1310H |
Product Overview : | Human C9orf12 partial ORF (NP_073592, 391 a.a. - 491 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | The protein encoded by this gene is a kinase that phosphorylates position 2 of inositol-1,3,4,5,6-pentakisphosphate to form inositol-1,2,3,4,5,6-hexakisphosphate (InsP6). InsP6 has a variety of functions, including stimulation of DNA repair, endocytosis, and mRNA export. [provided by RefSeq, Nov 2010] |
Molecular Mass : | 36.85 kDa |
AA Sequence : | VQQYRVAMTAKDCSIMIALSPCLQDASSDQRPVVPSSRSRFAFSVSVLDLDLKPYESIPHQYKLDGKIVNYYSKTVRAKDNAVMSTRFKESEDCTLVLHKV |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | IPPK inositol 1,3,4,5,6-pentakisphosphate 2-kinase [ Homo sapiens ] |
Official Symbol | IPPK |
Synonyms | IPPK; inositol 1,3,4,5,6-pentakisphosphate 2-kinase; C9orf12, chromosome 9 open reading frame 12; inositol-pentakisphosphate 2-kinase; FLJ13163; INSP5K2; IP5K; IPK1; IPK1 homolog; insP5 2-kinase; ins(1,3,4,5,6)P5 2-kinase; bA476B13.1 (novel protein); C9orf12; bA476B13.1; KIAA0699; |
Gene ID | 64768 |
mRNA Refseq | NM_022755 |
Protein Refseq | NP_073592 |
UniProt ID | Q9H8X2 |
◆ Recombinant Proteins | ||
IPPK-5590C | Recombinant Chicken IPPK | +Inquiry |
IPPK-8269M | Recombinant Mouse IPPK Protein | +Inquiry |
IPPK-2745R | Recombinant Rat IPPK Protein, His (Fc)-Avi-tagged | +Inquiry |
IPPK-1310H | Recombinant Human IPPK Protein, GST-Tagged | +Inquiry |
Ippk-3566M | Recombinant Mouse Ippk Protein, Myc/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
IPPK-5181HCL | Recombinant Human IPPK 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All IPPK Products
Required fields are marked with *
My Review for All IPPK Products
Required fields are marked with *
0
Inquiry Basket