Recombinant Human IQCF1 Protein, GST-tagged

Cat.No. : IQCF1-5066H
Product Overview : Human IQCF1 full-length ORF ( NP_689610.1, 1 a.a. - 205 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : IQCF1 (IQ Motif Containing F1) is a Protein Coding gene. An important paralog of this gene is IQCF5.
Molecular Mass : 50.1 kDa
AA Sequence : MEEKQPQKTKEPSKEDEPQQKEMPTHLSLGAESKAEAKTPVLVETQTVDNANEKSEKPPENQKKLSDKDTVATKIKAWWRGTLVRRALLHAALSACIIQCWWRLILSKILKKRRQAALEAFSRKEWAAVTLQSQARMWRIRRRYCQVLNAVRIIQAYWRCRSCASRGFIKGQYRVTANQLHLQLEILLDSGPCIVTECIPFSIKE
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name IQCF1 IQ motif containing F1 [ Homo sapiens ]
Official Symbol IQCF1
Synonyms IQCF1; IQ motif containing F1; IQ domain-containing protein F1; MGC39725; FLJ27508;
Gene ID 132141
mRNA Refseq NM_152397
Protein Refseq NP_689610
UniProt ID Q8N6M8

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All IQCF1 Products

Required fields are marked with *

My Review for All IQCF1 Products

Required fields are marked with *

0
cart-icon