Recombinant Human IQCF1 Protein, GST-tagged
| Cat.No. : | IQCF1-5066H |
| Product Overview : | Human IQCF1 full-length ORF ( NP_689610.1, 1 a.a. - 205 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | IQCF1 (IQ Motif Containing F1) is a Protein Coding gene. An important paralog of this gene is IQCF5. |
| Molecular Mass : | 50.1 kDa |
| AA Sequence : | MEEKQPQKTKEPSKEDEPQQKEMPTHLSLGAESKAEAKTPVLVETQTVDNANEKSEKPPENQKKLSDKDTVATKIKAWWRGTLVRRALLHAALSACIIQCWWRLILSKILKKRRQAALEAFSRKEWAAVTLQSQARMWRIRRRYCQVLNAVRIIQAYWRCRSCASRGFIKGQYRVTANQLHLQLEILLDSGPCIVTECIPFSIKE |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | IQCF1 IQ motif containing F1 [ Homo sapiens ] |
| Official Symbol | IQCF1 |
| Synonyms | IQCF1; IQ motif containing F1; IQ domain-containing protein F1; MGC39725; FLJ27508; |
| Gene ID | 132141 |
| mRNA Refseq | NM_152397 |
| Protein Refseq | NP_689610 |
| UniProt ID | Q8N6M8 |
| ◆ Recombinant Proteins | ||
| IQCF1-5709HF | Recombinant Full Length Human IQCF1 Protein, GST-tagged | +Inquiry |
| IQCF1-8275M | Recombinant Mouse IQCF1 Protein | +Inquiry |
| IQCF1-2440H | Recombinant Human IQCF1 Protein, GST/His-tagged | +Inquiry |
| IQCF1-5066H | Recombinant Human IQCF1 Protein, GST-tagged | +Inquiry |
| IQCF1-4589M | Recombinant Mouse IQCF1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| IQCF1-5177HCL | Recombinant Human IQCF1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All IQCF1 Products
Required fields are marked with *
My Review for All IQCF1 Products
Required fields are marked with *
