Recombinant Human IQCH Protein, GST-tagged

Cat.No. : IQCH-4237H
Product Overview : Human FLJ12476 partial ORF ( NP_073621, 301 a.a. - 400 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : IQCH (IQ Motif Containing H) is a Protein Coding gene.
Molecular Mass : 36.74 kDa
AA Sequence : LSQLITDHLQIQRWLFKMDSEFRGNGTAFCDIPSYLKCYKWVLKESSRYGLEDWRKKWAQEPALVKISEELAGILAQHAQPVNEKRFPTWRKFLQTFLSQ
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name IQCH IQ motif containing H [ Homo sapiens ]
Official Symbol IQCH
Synonyms IQCH; IQ motif containing H; IQ domain-containing protein H; FLJ12476; testis development protein NYD-SP5; NYDSP5; DKFZp434F2114;
Gene ID 64799
mRNA Refseq NM_001031715
Protein Refseq NP_001026885
MIM 612523
UniProt ID Q86VS3

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All IQCH Products

Required fields are marked with *

My Review for All IQCH Products

Required fields are marked with *

0
cart-icon