Recombinant Human IQCH Protein, GST-tagged
Cat.No. : | IQCH-4237H |
Product Overview : | Human FLJ12476 partial ORF ( NP_073621, 301 a.a. - 400 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | IQCH (IQ Motif Containing H) is a Protein Coding gene. |
Molecular Mass : | 36.74 kDa |
AA Sequence : | LSQLITDHLQIQRWLFKMDSEFRGNGTAFCDIPSYLKCYKWVLKESSRYGLEDWRKKWAQEPALVKISEELAGILAQHAQPVNEKRFPTWRKFLQTFLSQ |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | IQCH IQ motif containing H [ Homo sapiens ] |
Official Symbol | IQCH |
Synonyms | IQCH; IQ motif containing H; IQ domain-containing protein H; FLJ12476; testis development protein NYD-SP5; NYDSP5; DKFZp434F2114; |
Gene ID | 64799 |
mRNA Refseq | NM_001031715 |
Protein Refseq | NP_001026885 |
MIM | 612523 |
UniProt ID | Q86VS3 |
◆ Recombinant Proteins | ||
IQCH-4168Z | Recombinant Zebrafish IQCH | +Inquiry |
IQCH-4237H | Recombinant Human IQCH Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
IQCH-348HCL | Recombinant Human IQCH lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All IQCH Products
Required fields are marked with *
My Review for All IQCH Products
Required fields are marked with *
0
Inquiry Basket