Recombinant Human IQCK protein, His-tagged
Cat.No. : | IQCK-6744H |
Product Overview : | Recombinant Human IQCK protein(1-287 aa), fused with N-terminal His tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-287 aa |
Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 7.4). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. |
AASequence : | MAAPRQIPSHIVRLKPSCSTDSSFTRTPVPTVSLASRELPVSSWQVTEPSSKNLWEQICKEYEAEQPPFPEGYKVKQEPVITVAPVEEMLFHGFSAEHYFPVSHFTMISRTPCPQDKSETINPKTCSPKEYLETFIFPVLLPGMASLLHQAKKEKCFERKRTKFIACDFLTEWLYNQNPKRAGEPFTEFFSIPFVEERLKQHPRPPIPLSLLLTEEEAALYIQSFWRACVVRCDPEIQELRQWQKKLREAKHIHQQVKIFWAKQEQKVKCKMEDDAVPAAKMKIPSS |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
Gene Name | IQCK IQ motif containing K [ Homo sapiens ] |
Official Symbol | IQCK |
Synonyms | IQCK; IQ motif containing K; IQ domain-containing protein K; FLJ36575; MGC35048; FLJ20115; |
Gene ID | 124152 |
mRNA Refseq | NM_153208 |
Protein Refseq | NP_694940 |
UniProt ID | Q8N0W5 |
◆ Recombinant Proteins | ||
IQCK-5716HF | Recombinant Full Length Human IQCK Protein, GST-tagged | +Inquiry |
IQCK-6743H | Recombinant Human IQCK protein, GST-tagged | +Inquiry |
IQCK-7036Z | Recombinant Zebrafish IQCK | +Inquiry |
IQCK-5062H | Recombinant Human IQCK Protein, GST-tagged | +Inquiry |
IQCK-2109R | Recombinant Rhesus Macaque IQCK Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
IQCK-5176HCL | Recombinant Human IQCK 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All IQCK Products
Required fields are marked with *
My Review for All IQCK Products
Required fields are marked with *