Recombinant Human IQGAP2 protein, GST-tagged

• Cat.No.: IQGAP2-24H
• Product Overview: Recombinant Human IQGAP2(343 a.a. - 449 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Protein Length: 343-449 a.a.
• Description: This gene encodes a member of the IQGAP family. The protein contains three IQ domains, one calponin homology domain, one Ras-GAP domain and one WW domain. It interacts with components of the cytoskeleton, with cell adhesion molecules, and with several signaling molecules to regulate cell morphology and motility.
• Form: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
• Molecular Mass: 37.51 kDa
• AA Sequence: MYQNELFNLQKQNTMNYLAHEELLIAVEMLSAVALLNQALESNDLVSVQNQLRSPAIGLNNLDKAYVERYANTLL SVKLEVLSQGQDNLSWNEIQNCIDMVNAQIQE
• Applications: Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.

Gene Information

• Gene Name: IQGAP2 IQ motif containing GTPase activating protein 2 [ Homo sapiens ]
• Official Symbol: IQGAP2
• Synonyms: IQGAP2; IQ motif containing GTPase activating protein 2; ras GTPase-activating-like protein IQGAP2
• Gene ID: 10788
• mRNA Refseq: NM_006633
• Protein Refseq: NP_006624
• MIM: 605401
• UniProt ID: Q13576
• Chromosome Location: 5q13.3
• Pathway: G13 Signaling Pathway, organism-specific biosystem; Regulation of actin cytoskeleton, organism-specific biosystem; Regulation of actin cytoskeleton, conserved biosystem; TNF-alpha/NF-kB Signaling Pathway, organism-specific biosystem
• Function: GTPase inhibitor activity; Ras GTPase activator activity; actin binding; calmodulin binding