Recombinant Human IQGAP2 protein, GST-tagged

Cat.No. : IQGAP2-24H
Product Overview : Recombinant Human IQGAP2(343 a.a. - 449 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Protein Length : 343-449 a.a.
Description : This gene encodes a member of the IQGAP family. The protein contains three IQ domains, one calponin homology domain, one Ras-GAP domain and one WW domain. It interacts with components of the cytoskeleton, with cell adhesion molecules, and with several signaling molecules to regulate cell morphology and motility.
Form : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass : 37.51 kDa
AA Sequence : MYQNELFNLQKQNTMNYLAHEELLIAVEMLSAVALLNQALESNDLVSVQNQLRSPAIGLNNLDKAYVERYANTLL SVKLEVLSQGQDNLSWNEIQNCIDMVNAQIQE
Applications : Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Gene Name IQGAP2 IQ motif containing GTPase activating protein 2 [ Homo sapiens ]
Official Symbol IQGAP2
Synonyms IQGAP2; IQ motif containing GTPase activating protein 2; ras GTPase-activating-like protein IQGAP2;
Gene ID 10788
mRNA Refseq NM_006633
Protein Refseq NP_006624
MIM 605401
UniProt ID Q13576
Chromosome Location 5q13.3
Pathway G13 Signaling Pathway, organism-specific biosystem; Regulation of actin cytoskeleton, organism-specific biosystem; Regulation of actin cytoskeleton, conserved biosystem; TNF-alpha/NF-kB Signaling Pathway, organism-specific biosystem;
Function GTPase inhibitor activity; Ras GTPase activator activity; actin binding; calmodulin binding;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All IQGAP2 Products

Required fields are marked with *

My Review for All IQGAP2 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon