Recombinant Human IQGAP2 protein, GST-tagged
Cat.No. : | IQGAP2-24H |
Product Overview : | Recombinant Human IQGAP2(343 a.a. - 449 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Protein Length : | 343-449 a.a. |
Description : | This gene encodes a member of the IQGAP family. The protein contains three IQ domains, one calponin homology domain, one Ras-GAP domain and one WW domain. It interacts with components of the cytoskeleton, with cell adhesion molecules, and with several signaling molecules to regulate cell morphology and motility. |
Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Molecular Mass : | 37.51 kDa |
AA Sequence : | MYQNELFNLQKQNTMNYLAHEELLIAVEMLSAVALLNQALESNDLVSVQNQLRSPAIGLNNLDKAYVERYANTLL SVKLEVLSQGQDNLSWNEIQNCIDMVNAQIQE |
Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Gene Name | IQGAP2 IQ motif containing GTPase activating protein 2 [ Homo sapiens ] |
Official Symbol | IQGAP2 |
Synonyms | IQGAP2; IQ motif containing GTPase activating protein 2; ras GTPase-activating-like protein IQGAP2; |
Gene ID | 10788 |
mRNA Refseq | NM_006633 |
Protein Refseq | NP_006624 |
MIM | 605401 |
UniProt ID | Q13576 |
Chromosome Location | 5q13.3 |
Pathway | G13 Signaling Pathway, organism-specific biosystem; Regulation of actin cytoskeleton, organism-specific biosystem; Regulation of actin cytoskeleton, conserved biosystem; TNF-alpha/NF-kB Signaling Pathway, organism-specific biosystem; |
Function | GTPase inhibitor activity; Ras GTPase activator activity; actin binding; calmodulin binding; |
◆ Recombinant Proteins | ||
IQGAP2-10H | Recombinant Human IQGAP2 protein(519-727 aa), His-tagged | +Inquiry |
IQGAP2-24H | Recombinant Human IQGAP2 protein, GST-tagged | +Inquiry |
IQGAP2-11H | Recombinant Human IQGAP2 protein(231-530 aa), His-tagged | +Inquiry |
IQGAP2-8453H | Recombinant Human IQGAP2 protein, GST-tagged | +Inquiry |
IQGAP2-5140C | Recombinant Chicken IQGAP2 | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All IQGAP2 Products
Required fields are marked with *
My Review for All IQGAP2 Products
Required fields are marked with *