Recombinant Human IQ motif containing GTPase activating protein 2 Protein, His-tagged

Cat.No. : IQGAP2-001H
Product Overview : Recombinant Human IQGAP2 Protein (444-633aa) with C-His-tag was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 444-633aa
Description : This gene encodes a member of the IQGAP family. The encoded protein contains three IQ domains, one calponin homology domain, one Ras-GAP domain and one WW domain. This protein interacts with components of the cytoskeleton, with cell adhesion molecules, and with several signaling molecules to regulate cell morphology and motility. It also acts as a tumor suppressor and has been found to play a role in regulating innate antiviral responses. Alternative splicing results in multiple transcript variants.
Tag : C-His
Molecular Mass : 23 kDa
AA Sequence : MNAQIQEENDRVVAVGYINEAIDEGNPLRTLETLLLPTANISDVDPAHAQHYQDVLYHAKSQKLGDSESVSKVLWLDEIQQAVDDANVDKDRAKQWVTLVVDVNQCLEGKKSSDILSVLKSSTSNANDIIPECADKYYDALVKAKELKSERVSSDGSWLKLNLHKKYDYYYNTDSKESSWVTPESCLYKESHHHHHHHH
Endotoxin : < 1 EU/μg by LAL.
Purity : > 90 % by SDS-PAGE
Storage : Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
Concentration : 1 mg/mL by BCA
Storage Buffer : Sterile PBS, pH7.4
Gene Name IQGAP2 IQ motif containing GTPase activating protein 2 [Homo sapiens (human)]
Official Symbol IQGAP2
Synonyms IQGAP2; IQ motif containing GTPase activating protein 2; ras GTPase-activating-like protein IQGAP2
Gene ID 10788
mRNA Refseq NM_006633
Protein Refseq NP_006624
MIM 605401
UniProt ID Q13576

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All IQGAP2 Products

Required fields are marked with *

My Review for All IQGAP2 Products

Required fields are marked with *

0
cart-icon
0
compare icon